Cherry SNP DataBase

Gene information

Gene Pav_sc0002004.1_g110.1.mk
Chromosome name PAV_r1.0chr6
start 16826617
end 16829250
PAV_r1.0 name Pav_sc0002004.1
start 43899
end 46532
direction +
Annotation NR PREDICTED: ribonuclease P protein subunit p25-like protein isoform X2
Sequence CDS ATGGATAAGTTCCAGAGGGTGGAGAAGCCCAAGGCCGAGGCTGCGCCTATAAATGAGAAT GAGATTCGCATAACCGCTCAAGGCAGAATGAGGAACTATATTACTTACGCCACCACTCTC CTTCAGGAGAAAGGGTCTGATGAAATTATTCTCAAGGCAATGGGCAGAGCTATCAATAAA ACTGTGATGATTGCTGAACTAATAAAGCTCTTCTACTTCCAGAGAAGGATTGTTGGTCTC CATCAGAATACTTCAATTGGATCAACTGATATTACCGACGTGTATGAGCCCCTGGAAGAA GGCCTGGATCGTGTAGAGAGTACTCGGCATGTTTCAATGATCACTATTACTTTGTCGAAG ACGGAGCTTCATACATCCTCTACAGGATACCAACCCCCTCTTCCGGCTGACCAAGTGAAG CCATTGAATGATTTTGAGGATAATGGAGAGGGTTCGCCTAGATTCCGAGGCAGGGGTCGT GGTGGCCGAGGACAAGCTAGGGATAGAGGAAACTACAATGGGGTTGGGGATTATAATGGA GATGGTTGGGATGGTGGGCGTGGTTATGGTGGCAGAGGTAGAGGCCGTGGAAGAGGTGGT TCTTTTAGGGGACGAGGAAGAGGCTATGGTCAGTCGGGTGGATACTATGACTATGTTGAA GGTGCACCTGCCCAAGGTCGCGGTAAGTTCTTGGAGTAG
PEP MDKFQRVEKPKAEAAPINENEIRITAQGRMRNYITYATTLLQEKGSDEIILKAMGRAINK TVMIAELIKLFYFQRRIVGLHQNTSIGSTDITDVYEPLEEGLDRVESTRHVSMITITLSK TELHTSSTGYQPPLPADQVKPLNDFEDNGEGSPRFRGRGRGGRGQARDRGNYNGVGDYNG DGWDGGRGYGGRGRGRGRGGSFRGRGRGYGQSGGYYDYVEGAPAQGRGKFLE


| Top |