Cherry SNP DataBase

Gene information

Gene Pav_sc0002019.1_g070.1.br
Chromosome name PAV_r1.0chr7
start 17733772
end 17736559
PAV_r1.0 name Pav_sc0002019.1
start 31575
end 34362
direction +
Annotation NR PREDICTED: ankyrin-1
Sequence CDS ATGCAGAGGTATCCGGATCAACGGTCAAGATCTGCCAAGCCCGTCACCATTCATGGCTAC GCTCAGTCCGGGGACCTTCTTGGGTTTCAGAAGCTGCTCCGGGAAAACCCATCTCTTCTA AACGAAAGAAATGCCGTTATGGCACAAACTCCACTTCATGTTTCTGCTGGTTACAACAAG GCTGAGATAGTTAAATTTCTTCTTGATTGGCAAGGGCCAGATAAGGTTGAGTTGGAAGCC AGGAACATGTATGGAGAAACACCATTGCACATGGCAGCTAAGAATGGATGCAATGATGCT GCACGGTTGCTTCTTGTTCATGGTGCTTCTATTGAAGCCAAAGCAAATAATGGAATGACA CCATTACACCTTGCTGTGTGGTACTCACTTCGAGCAGAAGAGTTCTCAACTGTCAAAACA TTACTTGAGTACAATGCTGATTGCAGTGCTAAGGACGATGAGGGTATGACTCCCCTAAAT CACCTTTCAAAAGGCCGTGAAAATGGAAAGCTGCAGGCACTATTACTGTCTCACTTTGAA GAGCAGAGGAGGAGAAGAGCAATTGAAGCATGCAGCGAAACGAAAGCTAAGATGGATGAA CTTGAAAATGAATTATCAAATATTGTTGGTTTGCATGAGCTCAAGGTACAACTACGGAAA TGGGCAAAGGGGATGCTTTTGGATGAGAGGCGTAAGGCCCTTGGGCTGAAGGTTGGCACA AGGAGACCCCCTCATATGGCGTTTCTTGGCAATCCTGGAACAGGTAAGACAATGGTAGCT CGAATTCTTGGAAGATTACTCCATATGGTGGGAATTCTACCTACTGACAAAGTAACAGAA GTACAGCGAACTGATTTGGTTGGGGAATTTGTTGGTCATACTGGACCAAAAACTAGGAGG AAGATTAAAGACGCAGAGGGAGGAATTCTTTTTGTAGATGAAGCTTATCGACTAATACCT ATGCAGAAGGCAGACGATAAAGACTATGGTTTGGAAGCATTGGAAGAGATCATGTCTGTC ATGGATAGTGGAAAAATTGTAGTCATATTTGCGGGATATAGCGAACCAATGAAACGAGTA ATTGCTTCCAATGAAGGTTTCTGCCGGCGTGTGACCAAGTTTTTCAATTTTAGCGACTTC AGTTCCGAAGACCTAGCAAAGATTCTCCATATCAAGATGAACAATCAAACAGAGGAAAGC TTGTTGTATGGGTTTCAGTTACATTCTTCTTGCAGTATAGAAGCTGTTGCAGAACTGATT CGAGAAGAGACAACAGAAAAGCAGTGTAAGGAGATGAATGGAGGTTTAGTGGATACGATG TTAGTTAATGCTAGAGAGAGTTTGGACCTTAGGCTCAATTTTGACTGTATAGACACAGAT GAACTTAGAACAATCACCCTAGAGGATTTACAAGCAGGCCTTCGGATTTTGTCACAATGA
PEP MQRYPDQRSRSAKPVTIHGYAQSGDLLGFQKLLRENPSLLNERNAVMAQTPLHVSAGYNK AEIVKFLLDWQGPDKVELEARNMYGETPLHMAAKNGCNDAARLLLVHGASIEAKANNGMT PLHLAVWYSLRAEEFSTVKTLLEYNADCSAKDDEGMTPLNHLSKGRENGKLQALLLSHFE EQRRRRAIEACSETKAKMDELENELSNIVGLHELKVQLRKWAKGMLLDERRKALGLKVGT RRPPHMAFLGNPGTGKTMVARILGRLLHMVGILPTDKVTEVQRTDLVGEFVGHTGPKTRR KIKDAEGGILFVDEAYRLIPMQKADDKDYGLEALEEIMSVMDSGKIVVIFAGYSEPMKRV IASNEGFCRRVTKFFNFSDFSSEDLAKILHIKMNNQTEESLLYGFQLHSSCSIEAVAELI REETTEKQCKEMNGGLVDTMLVNARESLDLRLNFDCIDTDELRTITLEDLQAGLRILSQ


| Top |