Cherry SNP DataBase

Gene information

Gene Pav_sc0002055.1_g240.1.mk
Chromosome name PAV_r1.0chr3
start 12395396
end 12400472
PAV_r1.0 name Pav_sc0002055.1
start 123634
end 128710
direction +
Annotation NR PREDICTED: serine hydroxymethyltransferase 3, chloroplastic-like
Sequence CDS ATGGAGGCTTGTGGTGGAGCTGCAGTGATGGGTTCTCTTCAACAGCCCAGTTGGACCAAA GGAACAATTTTCCCAAACAAGGGGCTTATCGGTACTGGATTTTCACATAAACTAAAGCTC ACTTGTGTGAAGCCCGTTAGATCTTCTTCTTCTTACATTGAAGGAAGCTTGGTTGCTGGA AGGCCATCCTCTTCTGTCTCTGTGACTTTGCCTGAAATTGGTGAGAATTTTACTTATCGG GCAGTTATGGAGGCAGTTGGCTCATGTCTCACGAACAAGTATTCGGAAGGATTACCAGGT AAAAGGTACTATGGTGGCAATGAGCACATTGATGAGCTTGAAACACTATGCCAAAACAGG GCTCTAGATGCATTTCACTTAGATGGAAAGAAGTGGGGTGTTAATGTTCAACCATTATCT GGTTCTCCTGCTAATTTCGAGGTTTATACCGCAGTTCTTAAACCTCATGACCGTCTCATG GGTTTGGACTTGTCTCACGGTGGACATTTGTCTCATGGTTTCATGACTCCTAAAAGACGG GTATCAGGCACATCCATTTATTTTGAGTCCATGTCTTATCGACTCAATGAATCCACAGGT CTGGTTGATTATGACAAGCTTGAGGAAATGGCTGACCGATTTAAACCAAAACTCATTATT GCCGGGGCTAGTGCTTATCCTCGAGATTTTGACTACCCTCGCATGAGGAAGATTGCGGAT GCTGTTGGTGCTTTTCTTATGATGGATATGGCTCACATAAGTGGGCTTGTTGCTGCTTCT GTGCTTGCAAATCCTTTTGACTACTGTGATATTGTAACCACAACAACACACAAGTCTTTG AGAGGTCCTAGAGGTGGAATGATCTTCTTCAAGAAAGATCCAGTTCTTGGCGTTGATCTA GAATCTGCCATCAACAATGCTGTTTTTCCAGGTTTACAGGGTGGTCCTCATAACCACACT ATTGGGGGCCTTGCAGTTTGCTTGAAGTATGCACAGTCCCCAGAATTTAAGGCTTACCAG AATAAGGTGGTCTCTAATTGCAAGGCTCTTGCAAGCCGATTGATTGAACTTGGGTATAAA CTAGTTTCTGGTGGAAGTGATAACCATCTGGTTCTTGTGGATCTGCGGCCTTTAGGTATT GATGGAGCTCGAGTGGAGAAAATTCTTGACAAGGCTTCTATCACCCTTAACAAGAATTCA GTACCCGGAGATAAAAGTGCTGTAGTTCCTGGTGGCATTCGCATTGGGTCACCTGCCATG ACAACAAGAGGATTCACTGAGAAAGATTTCATAGCTGTTGCAGACTACATTCATGAGGGT GTGCAGATAACAATTGATGCTAAACGAGCAGTCTCAGGATCAAAGCTCCAAGATTTTATG AAGTTTGTAGCTTCACCTGAATTCTCCCTAAAGGATCGAGTGTTGGATCTGCAGAGAAGA GTTGAAGCTCTTACCACTCAGTTCCCAATGCCTGGAGTATAA
PEP MEACGGAAVMGSLQQPSWTKGTIFPNKGLIGTGFSHKLKLTCVKPVRSSSSYIEGSLVAG RPSSSVSVTLPEIGENFTYRAVMEAVGSCLTNKYSEGLPGKRYYGGNEHIDELETLCQNR ALDAFHLDGKKWGVNVQPLSGSPANFEVYTAVLKPHDRLMGLDLSHGGHLSHGFMTPKRR VSGTSIYFESMSYRLNESTGLVDYDKLEEMADRFKPKLIIAGASAYPRDFDYPRMRKIAD AVGAFLMMDMAHISGLVAASVLANPFDYCDIVTTTTHKSLRGPRGGMIFFKKDPVLGVDL ESAINNAVFPGLQGGPHNHTIGGLAVCLKYAQSPEFKAYQNKVVSNCKALASRLIELGYK LVSGGSDNHLVLVDLRPLGIDGARVEKILDKASITLNKNSVPGDKSAVVPGGIRIGSPAM TTRGFTEKDFIAVADYIHEGVQITIDAKRAVSGSKLQDFMKFVASPEFSLKDRVLDLQRR VEALTTQFPMPGV


| Top |