Cherry SNP DataBase

Gene information

Gene Pav_sc0002057.1_g020.1.mk
Chromosome name PAV_r1.0chr1
start 10359986
end 10363638
PAV_r1.0 name Pav_sc0002057.1
start 7272
end 10924
direction -
Annotation NR PREDICTED: uncharacterized protein At1g04910-like
Sequence CDS ATATGTAATGCTGTTCTTGCAGCAAGAATCATGAATGCTACACTTGTGCTGCCTGAATTG GATGCAAACTCTTTTTGGCATGATGACAGTGGTTTCCGCGGTATCTATGATGTTGAGCAT TTTATCATGTCATTGAGGTATGATGTAAAAATTGTAGAAAAAATACCAGAAATTCGCAAA AATGGGAAGGCAAAGAAGATAAAAGCCGTACAGCTTCGTCCCCCTAGAGATGCTCCTATC AGTTGGTATACTACGGATGCTCTTGCGAAAATGAAGGAGCATGGTGCTATTTATCTTACT CCCTTTTCACATCGTTTGGCAGAAGAAATTGACAACCCTGAGTATCAACGGTTGAGGTGC AGAGTGAACTATCATGCTCTGAGATTTAAGACAAATATAATCAAGCTAAGTCAGTCAATA GTTGATAAGCTTCGCTCACAAGGTCACTTCATGTCCATACATCTTCGTTTTGAAATGGAT ATGCTGGCATTTGCTGGCTGTTTTGATATTTTCAACCCCAAAGAGCAAGAGATTTTGAAG AAGTATCGGAAAGAAAATTTTGCACCAAAGAAGCTTGTGTATGAGGAAAGAAGAGCCATT GGAAAATGCCCATTAATTCCAGAAGAGGTTGGTCTTATTTTACGTGCAATGGGGTTTAGC AATTCTACCAAGATATACCTAGCTGCTGGTGAACTATTTGGTGGAGAGAGATTCATGAAA CCGTTCCGGGCTTTGTTCCCTCACCTTGAGAACCACAGTTCTGTAGATCCCACAGACGAG CTAGCAGAAAATACCCAGGGATTGTTAGGGTCTGCGGTGGACTACATGGTTTGCCTCCTC TCTGATATTTTTATGCCTACATATGATGGCCCTAGCAACTTTGCCAACAATCTCCTTGGA CACCGCCTATATTATGGCTTCCGGACCACAATTAGACCCGATAGGAAAGCTCTTGCTCCA ATCTTCGTGGATCTAGAGAAGGGATGGACAACGGGTTTTGACCACAATTAG
PEP ICNAVLAARIMNATLVLPELDANSFWHDDSGFRGIYDVEHFIMSLRYDVKIVEKIPEIRK NGKAKKIKAVQLRPPRDAPISWYTTDALAKMKEHGAIYLTPFSHRLAEEIDNPEYQRLRC RVNYHALRFKTNIIKLSQSIVDKLRSQGHFMSIHLRFEMDMLAFAGCFDIFNPKEQEILK KYRKENFAPKKLVYEERRAIGKCPLIPEEVGLILRAMGFSNSTKIYLAAGELFGGERFMK PFRALFPHLENHSSVDPTDELAENTQGLLGSAVDYMVCLLSDIFMPTYDGPSNFANNLLG HRLYYGFRTTIRPDRKALAPIFVDLEKGWTTGFDHN


| Top |