Cherry SNP DataBase

Gene information

Gene Pav_sc0002057.1_g100.1.mk
Chromosome name PAV_r1.0chr1
start 10431502
end 10447415
PAV_r1.0 name Pav_sc0002057.1
start 78788
end 94701
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103322777
Sequence CDS ATGTACGGACGCCCTTCTAGCTCCTCCGGCGGCGCATGGGGTCAGCCGCCGCAGCAACCT CAAGGCACTAATTTCTATCTGCAAAACCCCATCAATTCGTCGTATATTTATCCTTCAAAC CCCCCCTTTATACCCCACAATGCCCACAACCCCTACCAAAACTTCCCTCCTAATAATTTC CCAATCCAAAGCCCTAATTTCGCTGTCCAAAACCCTGGATTTAATCCTCCTCCCCAGCAG TTTTCGAACCCGGCAGGGTTTCGGCCTCCGAACTCGAGAGATATGCTCGAGAAAATCGAC CGCGCCGTGGGGAAGGCTCGCGACGAACATGCCGCTGCTGGAGAGAACGTCTCGGCGTGG AAGGTCTCGCAGTCTGCGCTTCTGATGCTCAAGGTTGATTGCTGGAGTTCTCTGGGGTTT CAAATGCAGCAAGTGCCGACTATGCACCGCCTCATGCTCACTGAAGGGAAGATAAATGCA TTTATCCATTGTTTTGTTGGGGTTCGAAGAATTACTTCATTGTATGATTTGGAAGTAGCA ATCTGCAAGAATGAGGGAATTGAGCAGTTTGAAGAGCTGGGATTGGGCCCTTTGTTGCGA CATCCACTTGTCATGCATTATTTCTCAGTGAAGTCTGACACAACTGAAGTCTTTAAGATA ACTAGTGGGGAGATGATATCTCTACTTTCTGAGTTCATGGATACTTGTGAAAATAAAGAT ATTAGGGTTGAAGAATATTTAGATTTCATTGTTAAGAAGCGATCAGTTGCAAGCAAGGAA GCACTTGGAATACGAATTCACAGCATGGGGATGCATATTTCTGCCATCCGGGAAGCCAGG AATTTAGAAATTTCCACTCTAAAGAAATCAGAGAAGGCATTTCAGCCAAATTCAGATAAA AAGGATAGGAAGTTTCCACTTTTATCTGCAGAGAAAAAGGAGCTAGACAAACGTTTCAAC ACTATTTCTCAGCGCGTTGAATCATTTTCCCCCATACATAAGGATTTTTGTGGCAAGCAC ATTAGATTTGATCCTTCAAGCTCAGAGGATGAAGGTAGGGATGATTATTTATCTGAAGAG AATGATGAAAATAATGACCATGTAACAGGCAGTCAGGTTAACTTCTCATCACAGTCTGTT AAAAGTTCTGACAGAGTGAGTAGTTGTCCTTACCCATCTGTAATAGAAGAGAGGAGAAGG CTTGGGTTGAGCCAGCTTTCTCCAGCTAGTGGCAGCCAAAAGCACAATGATAGTAGCGGG TCTGTTAAAAAGAAAAGAAAATCTGAAAACATAAACAGTGCAATCTCCATGCCCCACAAA CTGCGTAAGAGAGATAAGGTACAAGATGCCCTTCCAATGGAAAATGGCAGGGAAACCAAT GAGGTTAGCAATTTGCATGAAAATGATCTTTCAATTGACAATAATGATTTGAGGATGTTC ATTACAACCTGGAAGGAGGCATGTCTGGAGTACACTGTGGATGAGGTACTTGATAGGATG ATGCAGTTTAATAATACTAAAGCTCAGAAGAGAGAGAAAATCAAGTCAATGTTTTCTTTG TATCCATTAATTGGATTACTAAATGTTGCTGTCTCATCTATCAAATGTGGAATGTGGGAT AGCATGTATGATACATTCCAAACCATTGGTCAATATGAATTAACTGACAGTATTACTGAT AACTGTCCCAAATATGTGAACATAGATGTTGAACCAAGTACTAAAGATGAGCCAAGAATT AAGGATCCACCAGTCATCAATGAACGTGTTTCTGTTGAGGACATAATCAGGAAAGTTACC ATGTATTTCGAGAGTGATCAAGGAAAACATAACAATGGTCAATCACTTCTGGAGAAGATA TTTATCTTTTTGAGAAAGCTTTGCAATTGCGAGGTTTGGTTGGTGAAAGAATTTTGTGTA AAGGAATTTAAATCCCTCGGTTATGGGGAGTTTTTGATGTTCTTAGAAAAATATGCTTGT CTACTGCCACATGAGCTGTGCAAGTTCCTGACTGGCGACTTGAGTGGAAAGTGTCCTATT GAGGTTTGCATGCACCAGCACCATTTGGTTGTTTTAGTATCTCAAGCTTTAAATAGTTTA TGGGAGGATGAAAAAGTTACCAAACAAAATATATTGTTGCTGCTTAGGAAGCAGTTCCCA TTGGTTTGTTTCAAAACTATCGAAAATGGTTCAGTGGAAGATTTCTTAAGCATAGTGGGA AAACATAAAAATGCTGCGAGTTCGAAATGTGTTCTATTTTCAATGACACTGTGTGGAACT AGTTATGCTATAGAGTCATCATTACACATTGAGAATGTCCTATGGAAAAGAACTTCGGTC AATACTGATAGTGGCCAGAAAGCAAAGTCCCATGAATCTGTTACATCCAAGGATGCAATT GAAGTCTTACTTACAGCACCAGTGATGTCAGATTTAAACTTATGGTCGCATTGGGACCTA TTGTTTGCTCCCTCTCTTGGCCCTCTTGTACCATGGCTATTGAATGAAGTCAACACAGAT GAACTGTTGTGTTTGGTGACAAAAGGTGGAAAAGTGATTCGGTTAGATCATTCAGCTACC GTGGATTCATTCTTGGAATCTGCACTTCAAGGATCCTCTTTTCAAACAGCAGTGAAAATG TTATCTCTGTTTTCGCTAGTTGGGGGAGAAAAACATGTCCCTGTGTCGCTTTTGAAAATT CATATAAAACATGCATTTGAAGTAATTCAGAAGAATTATCTAGACGATATAGAACTACAA GACAATCAGAATTCCATTAATTATGGAAAAGCACTATCTGGACAAAAAATGGTTGGTGAA GTTGCTACTGGTAAATTCTGTAGTAAATTACACAAGGACTTGAGCAAGATGAATATTGCT ACAACTGTTATATCAAGGTTTTTCCTTGAATGTCTTGGGTATCTACCTGCAGAATTTTGG TGTTTTGCTGCTGATGTATTGCTTTCTGGGATGCAATCTGTTGTTAAACATGCTGCTACA GCCGTTCTGAGTGAATGCACCCAATCAGAGCAGCATCTCATGCTTCATGAAGTTGGGTTG TCTCTTGGTGTAGTGGAGTGGATTAATGATTACTATGCATTTTGTTCCAGAGATGCTACT GGCTTGTTCATATCAGGGGCTTCATGTTTCAATGCTATTAGGTATGAAACAGGGTCAAGC TCAAAGAATATGCAAGATGTGTCAGATAAGTTTTCCGTTAGGGCAGATGAGCAGAAAGGC GGATGTACTGATATTTGTTTGAAGATTGGTGGAGCAGAAGCCTCTAATGCTAGTATTGGC AGTGGTTACACTCAACATCCTACTGAGCTTAATGAACATGAAGATGCAGCCCAGGTAATT GAGTCAATCAGGAGAGATGAATTTGGTCTTGATTCAGGCCTATCAAGTGTTGAAAGTATC ATGTTAAAGAAGCAGCATGCTCGCTTAGGGAGAGCTCTTCATTGTCTTTCACAGGAATTG TATTCACAGGATTCACATTTTCTTCTTGAGCTGGTCACAGATGCTCCAGAAATTCATTCC AATGGGTTTCATATCAAATTTGATATAAGTGAGGGTCAGATTGGTTTTGTTTTGCCAACA GTTGTACCTCCCTGCAATGTTGACTTGTTTAGTAGGCTTACTTCTAGTGACCATGACCAA TCAGATAATAACTGCTGGAACACTTGTGTTGTTCTTCCTTTCAGATCAAAAATATCGGAT GGAACTGTCATGAAAAGCATTATAAATATGTTTTCAGATCTTCATCCATCTTTATTACTC TTTCTGCACCGCCTCCAGTGTATCAAGTTTAGAAACTTGCTTGATGATTCACTTATTGTC ATGAGAAAAGAAATTTTGGGAGATGGTATTGTTAAGGTTTCACATGGGAAAGAGAAAATG ACATGGTTTGTAGTATCTCAGAAATTGCAAGCAGATTTTATTCGTAGTGATGTACAAACA ACAGAAATTTCAATAGCATTTACATTGAAGGAATCAGATAACGGTGATTATGATCCAGAT CTTGTCCAGCAGCCTGTTTTTGCATTTCTTCCTCTTAGAACATATGGACTGAAATTTATT CTTCAAGGTGATTTTGTCCTTCCTTCATCTAGAGAGGAAGTGGATGGAGATAGTCCCTGG AACCAGTGGCTGTTGTCAGAATTTCCTGGTTTATTTGTCAATGCGGAGAGATCTTTTTGT GCTCTTCCGTGCTTTAAAGAGAATCCTGGGAGAGCTGTGACAGCTTATATGTCCTTTGTT CCCCTTGTAGGTGAAGTGCATGGTTTCTTTTCTTCTCTTCCACGGTTGATTGTTTCTAGA TTACGTATGACTAATTGCTTACTTCTGGAAGGAGGAAATAATGAATGGGTTCCTCCTTGC AAGGTCCTAAGAGGTTGGAATGAACATGCTCATTCGCTTCTTCCTGACAGTTTACTACAA GAGCATCTTGGCCTTGGATTCTTGGATAGAAATATAGTTCTGCCAGATCCACTTTCAAAT GCAATAGGTATTGTGGAGTATGGACCCAAAGTTCTGCTTCAAGTTATGGTATCTTTATGT CATACGCAAAATGGTCTCAAATCAATGGGGTTGGGTTGGCTGGCCTCTTGGCTAAGTGAA CTTTATGCCATGTCATTCAATTCTTCTATGGAAGCTTCTTTTGATCCGAGAATACAAATG GAGCTCATAGAAAACCTTCGAAAAATTCCTTTCATTCCTCTTTCAGATGGTACATATGGT GCAGTAGACGAAGGCCCAATTTGGTTACATTTTGATGCCTTAAGCAATGGCCTTGAGGCT CAGTATGGACTTGAGTCTTTCCCAAATTTATATGCGAAACTTCGGTTCGTAAGTCCTACC CTCATTTCTACAGTGTCTGCAGATATGTCATCCATGGATGTGACAGTTGACAAACTCACA TGTATGCTCTGTAGAATTGGTGTCCAGAGGTTGTCTGCACATGAAATTGTCAAGGTGCAC ATCTTGCCAGCTATATCTGATGACAGAATTACAGATAGGGATAAGAATTTGGTGATTGAA TATCTCTGCTTTGTAATGTTCCACATACAGTCGAGCTGCTCTGATTGCAATGTTGAAAGG GAATACATTATCTCAGAAATACGAGATAAAGCTTACATATCAACAAATTATGGCTTTAAG CGACCTTCTGAGGTATCAATTCATTTCAGTAAAGAATTTGGAAATCCTGTGGACATAAAG AAGTTGATTAATATGGTGGATATAAAGTGGCATGAGGTTCACATCTCCTATTTGGGACAT CCAGTCATAAAATCACTCCCATGTGAACTGAAGAAGTGGAGGGAATTTTTCCAGCAAATT GGGATAACGGATTTTGTCAAAGTAGTGCAAGTTGAGAAGGGAATTGCTGATATTTCTGAT GTACTAGTTAAGAATATGATTTGGGATAAGGACTTAATTTCCCTTCGATCAAATGTCACA GATTGGGAGTCCCCTGAATTGGTCAACTTATTATCTCTATTGGCCAGAGATGGAAACAAA AAAGGTTGTGAATATCTCTTAGAGATTCTTGATACTTTATGGGATGATTGCTATAGTGAA AAAACTACATGTTATTGTGCTTCTAAATCTGAAGCAGACAGAAGGCCCTTCAAATCTTCA TTTATAAGTAGCATCTGTGATGTGGAATGGGTGGTATCAACGATGGATGATGTACTGCAC TATCCTAAAGATTTATATCACGATTGTGATGCAGTGCGCTCGATTCTGGGGGCATCTGCT CCATTTGCTATTCCAAAGGTGAGAAGTGAGAAGTTTGTACATGATGTTGGGTTTAAGACA ACAGTTTCCCTTGACGATGTTCTGGAGGTCTTGAAGCTATGGAGACGTGAGAACCCATTC AGTGCCAGCCTAGCACAAATGTTCAAATTTTACACATTAATCTGGAATGAATTGGCTGCT TCAAAGGAGAAAATTGCAGAGGCTTTCCATTCAGGACCTTCTATATTCGTTCCACACGCA TCTAGCTTCAGGCACGAGGATGTGGTATCTGGTACGTTGTTGTCCCCTGAAGAAGTGTAC TGGCATGACTCCACTTCCTTTGTAGACCAAATCAGGGAGATTCATCGTCAGTGCAGCTCA ACGGGTGTTACTCATGGCCCCTTGAATAAGACGCTTTGCAATTTCTACCCAGGCCTTCAT GACTTCTTTGTTGACGGCTGTGGAGTACATGAGACCCCTCCTCTCCGGAGCTACCTTCAG ATATTGCTGCATTTATCAAATGTTGCTTTGCCTTCACAAGCAGCTAATGCAGTTTTTCAA GTTTTCCTGAAGTGGACTGATGGACTAAAATCAGGATTGAGTGCTGAAGATGTTGTTTAC TTGAAAGATTCCCTTACAAAGATTGAGTGTACGGTGCTTCCTACTGTACAGGATAAGTGG GTTTCTGTACATCCTTCCTTTGGTCTTGTGTGCTGGTGTGATAATAAGAAATTAAGCAAG CAGTTTAAGCACTTGGACTGCATTGATTTTCTGTACTTCGGTGAACTGAACAAGGATGAT GAAGAGATGCTATGTACAAAAGTGTCCGTCCTCATGCACAATTTAGGGATTCCTGCTCTT TCAGAGGTTGTAACTCGTGAGGCAATATATTACAATATGGAAGACTCTAGCTTTAAAGCT GCATTGCTGGATTGGGCTCTTCCATACGCACAGCGCTACTTACATGGTGTACACCCAGAT AAATATTCTCAACTCAAGCAGTCTGAATTTGATATCCTGAATCACCTGCAAGTGGTAGTT GTTGAAAAGCTGTTCTACCGGAATGTTATAAAGAGTACTGGAAATGAATCCAAGAAGCGA GTTAAAAAAAGTGATAAATCACTTGAAACAAGTTTCAATTCACCAGAAGTAGATGAGCAA AACAGTTGGAAATCCAAAAGTAAAGCACGGAACTGGCCTCCTATTGGTTGGAAAACTGCA CCAGGGTTTGGGTATGCTCGTGCAAATGGTTTTAAGACACAGGCAGTTTCACAGCCTAGC ACCGCCTTACAAAATAAAGTGGGGGATGATTCTGAAGGTATCAGCAGGCAAACAGATGAT TTAACACCCATTTCAGTTGACACTAATTGGACCATTGAAGGTTGTTTGGCAACAACATCT GCGGCTTTTGTTTTGCCAGACTCCAATCATCTGCAAGAACATTGTGGTGAGGCTGGCAAT GAGGCTGACTTTCCAATGCATGTGGAGTGTAATCCTATTAGTTTTGATCTTGTGTCTGAC CCACCTGACTTTGGCTCATCTAATTTTAGCAAGAGAGATCAGCTTAGATTTGGTACACCC AATTCAACACAAGCAACTTTAACTGGGAGGCTAGGTGAGCTTGTTGCTTTTAAATACTTT GTTCAGAAAGCCGGCAAATCAGTTGTGAAGTGGGTCAATGAGCATCACGAAACTGGGCTA CCATATGACATAGTTATAGGGGACAAGGAAAACAGTAAAGAGTTCATCGAAGTTAAAGCA ACCAAGTCAGCAAGAAAAGACTGGTTCGAAATATCAATGAGAGAGTTGCAATTTGCGGTT GAGAAAGGTGAAGCTTTCAGCATTGCGCATGTCATTCTATTGGGTAATAATGTTGCAAGA GTCTCAGTATACAACAATCTGGCAAAATTGTGCCAGCTTCACAAACTGCGGTTGGCTGTC TTGTTGCCTGAGCAGCAGAGGGAATTTTCCATTGTGTCCCAATCGTAA
PEP MYGRPSSSSGGAWGQPPQQPQGTNFYLQNPINSSYIYPSNPPFIPHNAHNPYQNFPPNNF PIQSPNFAVQNPGFNPPPQQFSNPAGFRPPNSRDMLEKIDRAVGKARDEHAAAGENVSAW KVSQSALLMLKVDCWSSLGFQMQQVPTMHRLMLTEGKINAFIHCFVGVRRITSLYDLEVA ICKNEGIEQFEELGLGPLLRHPLVMHYFSVKSDTTEVFKITSGEMISLLSEFMDTCENKD IRVEEYLDFIVKKRSVASKEALGIRIHSMGMHISAIREARNLEISTLKKSEKAFQPNSDK KDRKFPLLSAEKKELDKRFNTISQRVESFSPIHKDFCGKHIRFDPSSSEDEGRDDYLSEE NDENNDHVTGSQVNFSSQSVKSSDRVSSCPYPSVIEERRRLGLSQLSPASGSQKHNDSSG SVKKKRKSENINSAISMPHKLRKRDKVQDALPMENGRETNEVSNLHENDLSIDNNDLRMF ITTWKEACLEYTVDEVLDRMMQFNNTKAQKREKIKSMFSLYPLIGLLNVAVSSIKCGMWD SMYDTFQTIGQYELTDSITDNCPKYVNIDVEPSTKDEPRIKDPPVINERVSVEDIIRKVT MYFESDQGKHNNGQSLLEKIFIFLRKLCNCEVWLVKEFCVKEFKSLGYGEFLMFLEKYAC LLPHELCKFLTGDLSGKCPIEVCMHQHHLVVLVSQALNSLWEDEKVTKQNILLLLRKQFP LVCFKTIENGSVEDFLSIVGKHKNAASSKCVLFSMTLCGTSYAIESSLHIENVLWKRTSV NTDSGQKAKSHESVTSKDAIEVLLTAPVMSDLNLWSHWDLLFAPSLGPLVPWLLNEVNTD ELLCLVTKGGKVIRLDHSATVDSFLESALQGSSFQTAVKMLSLFSLVGGEKHVPVSLLKI HIKHAFEVIQKNYLDDIELQDNQNSINYGKALSGQKMVGEVATGKFCSKLHKDLSKMNIA TTVISRFFLECLGYLPAEFWCFAADVLLSGMQSVVKHAATAVLSECTQSEQHLMLHEVGL SLGVVEWINDYYAFCSRDATGLFISGASCFNAIRYETGSSSKNMQDVSDKFSVRADEQKG GCTDICLKIGGAEASNASIGSGYTQHPTELNEHEDAAQVIESIRRDEFGLDSGLSSVESI MLKKQHARLGRALHCLSQELYSQDSHFLLELVTDAPEIHSNGFHIKFDISEGQIGFVLPT VVPPCNVDLFSRLTSSDHDQSDNNCWNTCVVLPFRSKISDGTVMKSIINMFSDLHPSLLL FLHRLQCIKFRNLLDDSLIVMRKEILGDGIVKVSHGKEKMTWFVVSQKLQADFIRSDVQT TEISIAFTLKESDNGDYDPDLVQQPVFAFLPLRTYGLKFILQGDFVLPSSREEVDGDSPW NQWLLSEFPGLFVNAERSFCALPCFKENPGRAVTAYMSFVPLVGEVHGFFSSLPRLIVSR LRMTNCLLLEGGNNEWVPPCKVLRGWNEHAHSLLPDSLLQEHLGLGFLDRNIVLPDPLSN AIGIVEYGPKVLLQVMVSLCHTQNGLKSMGLGWLASWLSELYAMSFNSSMEASFDPRIQM ELIENLRKIPFIPLSDGTYGAVDEGPIWLHFDALSNGLEAQYGLESFPNLYAKLRFVSPT LISTVSADMSSMDVTVDKLTCMLCRIGVQRLSAHEIVKVHILPAISDDRITDRDKNLVIE YLCFVMFHIQSSCSDCNVEREYIISEIRDKAYISTNYGFKRPSEVSIHFSKEFGNPVDIK KLINMVDIKWHEVHISYLGHPVIKSLPCELKKWREFFQQIGITDFVKVVQVEKGIADISD VLVKNMIWDKDLISLRSNVTDWESPELVNLLSLLARDGNKKGCEYLLEILDTLWDDCYSE KTTCYCASKSEADRRPFKSSFISSICDVEWVVSTMDDVLHYPKDLYHDCDAVRSILGASA PFAIPKVRSEKFVHDVGFKTTVSLDDVLEVLKLWRRENPFSASLAQMFKFYTLIWNELAA SKEKIAEAFHSGPSIFVPHASSFRHEDVVSGTLLSPEEVYWHDSTSFVDQIREIHRQCSS TGVTHGPLNKTLCNFYPGLHDFFVDGCGVHETPPLRSYLQILLHLSNVALPSQAANAVFQ VFLKWTDGLKSGLSAEDVVYLKDSLTKIECTVLPTVQDKWVSVHPSFGLVCWCDNKKLSK QFKHLDCIDFLYFGELNKDDEEMLCTKVSVLMHNLGIPALSEVVTREAIYYNMEDSSFKA ALLDWALPYAQRYLHGVHPDKYSQLKQSEFDILNHLQVVVVEKLFYRNVIKSTGNESKKR VKKSDKSLETSFNSPEVDEQNSWKSKSKARNWPPIGWKTAPGFGYARANGFKTQAVSQPS TALQNKVGDDSEGISRQTDDLTPISVDTNWTIEGCLATTSAAFVLPDSNHLQEHCGEAGN EADFPMHVECNPISFDLVSDPPDFGSSNFSKRDQLRFGTPNSTQATLTGRLGELVAFKYF VQKAGKSVVKWVNEHHETGLPYDIVIGDKENSKEFIEVKATKSARKDWFEISMRELQFAV EKGEAFSIAHVILLGNNVARVSVYNNLAKLCQLHKLRLAVLLPEQQREFSIVSQS


| Top |