Cherry SNP DataBase

Gene information

Gene Pav_sc0002099.1_g030.1.br
Chromosome name PAV_r1.0chr6
start 3529403
end 3530878
PAV_r1.0 name Pav_sc0002099.1
start 12563
end 14038
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103320005
Sequence CDS ATGCAGCATATTGAACTTATGCACATGTGGTATGCTCTGGATTTAGCTGTTCTTGCGGTT GGAGTGATGAAGGACTATGACTGGGGTGGAAGACAAGCATTGGAGTGGAGAGCGTCAATT GCCAAACATTTCATTGACGAGTGGGAATGGCAGTTGTCAATTTTGCAGCGTCTTCTTCCG TTATCTGAACGCCAGTGGCAGTGGAAGGAGGCATTAACTGTATTACGTCCTCACCATCTA AGCTACTTAACCTGTGAGTTACAAGCTTTTTCTTCTCTGGGAATTCATATGATGATCAAT TGGTTCTTGTGCATGAATTGCTTTTTGGATATTCGTTATAGATCACTGGATTGCAAAGGT AGTTTAACCTATAAGAAAATGGTAGAAGATGTAGTCTCTTGTGCTACTGATGGTGAGGCT TCTACAATACATGATCTGAATTTTTCTTCGTTGCGCTCCCAGTTAGGTCTTCTGACTGCA GCACCTGATGGTGACGGTGGATCAAGAGACTACGTGAGATTGATAGTGATACTGAGTCAA AAGTTGATGACATTGTTGGTAGCAGTAGTGTTTCAACAGCTTTTCCAGACGCCAGGGCAA GATGGTGCAGCTACTGAACCTTGGGATGATTCTTCAAAATCTGACGTTGCTGAGCTTGAC ATTTCAGTTTTCCTTTCTTTTGATTGGAAAAATGAAGAACCGTATGAGAAAGCTGTACAG CGGTATTGTAGTTCTGTCTTGTTTCAAAATTCATTCAAATGGACAATTACTTATTCACTT CTTCAGTTGACTCTATTGTTATGA
PEP MQHIELMHMWYALDLAVLAVGVMKDYDWGGRQALEWRASIAKHFIDEWEWQLSILQRLLP LSERQWQWKEALTVLRPHHLSYLTCELQAFSSLGIHMMINWFLCMNCFLDIRYRSLDCKG SLTYKKMVEDVVSCATDGEASTIHDLNFSSLRSQLGLLTAAPDGDGGSRDYVRLIVILSQ KLMTLLVAVVFQQLFQTPGQDGAATEPWDDSSKSDVAELDISVFLSFDWKNEEPYEKAVQ RYCSSVLFQNSFKWTITYSLLQLTLLL


| Top |