Cherry SNP DataBase

Gene information

Gene Pav_sc0002136.1_g080.1.mk
Chromosome name PAV_r1.0chr1
start 41753415
end 41762909
PAV_r1.0 name Pav_sc0002136.1
start 27491
end 36985
direction -
Annotation NR PREDICTED: crossover junction endonuclease EME1B-like
Sequence CDS ATGAAAGATGAAGATGGAGGGCGCACAGCAGAGAGGGCTCTAATGGGGTGGACTGGAAAT GCAAGATCAGGTGTCGAGAGGCTTGCTCTTTCTTTTCAGAAGTGCGTCCCTCTTCATTCG CAGTCTCAAATGTCGAAGCCTCAGCAGCCAATAGTCCTCTCCGACGACGAAGAAGAAAAT GACCAGAATGCCCTCTCCTCACCCCCTCCATTCCAACCATTCCACTGCTCTAATAAGAAA CGCCGAACCGGACTCTACCCCTACCCAAACCTCAATACTCAGACTCCGGTTCTCGTCCTT GACGACGACGACGACGCGACCAGACCGACACGGAAGCCACCGGGCCCCACCTCATCCCGC TACTTCGAGGTCCTTGACAGTCTCCATGCTCAAAAGCCCCTTCCGACTCCCAAGCTAGCG TTTCACATTCCCCGCCCAAGTTCTCCGGTTGGCATTAATGACTTGGTATTTCTGGAATCC GATAATGAGTCTGAAAGTAGTTCTGGAAGGGAAAGGGGGAAGGATAACAAATCAATTTCT AGTGGTTTTGGTGTGGCAAAGGGCTTAGATTGGAGTTCCAGATTTGTTGAATCCACATCT TCTCTTGGACATGACAATCTAGCACATATGTCTGAGGACTGTTCTACGCAACCTATTTCT TTGCAAGATGATTTTGATATTAATCAGGTACTTGATTATCCTGCTGACAAAGAAAATAGA ATGGATCAGATGGGCAACATTGTGAAACAGAGAAGAAAAACTAAAGCTATTACTGAAAAA AGTATTAGAGACGAAGCAATGGGTACAAGGAAGATGGCGAAAGAGGAAAGGATACGCCTA ATGGAAGAAAAGAATCTAAAGAAGCAACAAGAGAGGTTGCAAAGAGCAGCTCTGAAAGCT GAAGCAGCAGAGATGAAAAAGATTCAGAAAGAACAACAAAAGTGGGAAAAAGGAAAGTTT GCTGTGAAATCCATAGTGGCTGAGATTGACATTAAAGTAGTGGAATTGGGGTCAGTTGGA GGAAATCTGCTCACAAGGTTTGCTGAAAGAGGGATAACATACCGTATAACATCAAATCCA ATTGAAAGATCAATTGTCTGGACCATGACTGTTCCAGAACATATTTCACAGAGTTCTCCT GAACGAATAGAGATTCAATATGTATTGCTCGTGTATGAAGCTGAAGAATTTTGCAACCTT GTCATCAATGAATCTCTTTTGGACCATGTTTTTAGTGTTCGAAGTTGTTATCCATCCTAT ACAGTGTGTTATCTTACAAATAGGGAACAAGAAGTGTACAAGAACCTAACAAAGGATAAT GATTGGAGACGCCCGCCTGTTGAGGAGGTTGAACTACTAACAGAAAATGCTTTGGATTCC AACACATTAATGACTTCTGGATTTTCATTCATGTCTTGCAGAATAGTGGATCTGCAGTGC ATAGATGAGGCTGAACTTGCTGAACACATTGTTGGTTTGACGTGCAGCCTCTCATCCTGC CAATTTAGAAAGAAGTTAACGAGACTGGACGTAAATGCTAACGGCCCTCTTATGATTAAG GACTGTGTTGACCGGAATATAATTAATAAGTGCACGTGGTTAAAAGCTTTGGTAGCTATC CCAAAGGTACAGCCACGGTTTGCTATTGCTATATGGAAGAAGTACCCTACCATGAAATCT CTGTTGAGTGTTTACATGGATCAAAATGTATCGGTTCATCAAAAGGAATTTCTGCTGAAG GACTTGATAACTGAAGGTTTACTTCGTGATGACAGAAGAGTGGGTGAGGTTTGTTCCAAG AGAGTGTACAGAATACTTGTGGCACAAAGTGGATCCATTAAAACTGATGATGTTGAGGAT GGTGCTGATTTGTTTAGGCGTCAACTGGCGTAA
PEP MKDEDGGRTAERALMGWTGNARSGVERLALSFQKCVPLHSQSQMSKPQQPIVLSDDEEEN DQNALSSPPPFQPFHCSNKKRRTGLYPYPNLNTQTPVLVLDDDDDATRPTRKPPGPTSSR YFEVLDSLHAQKPLPTPKLAFHIPRPSSPVGINDLVFLESDNESESSSGRERGKDNKSIS SGFGVAKGLDWSSRFVESTSSLGHDNLAHMSEDCSTQPISLQDDFDINQVLDYPADKENR MDQMGNIVKQRRKTKAITEKSIRDEAMGTRKMAKEERIRLMEEKNLKKQQERLQRAALKA EAAEMKKIQKEQQKWEKGKFAVKSIVAEIDIKVVELGSVGGNLLTRFAERGITYRITSNP IERSIVWTMTVPEHISQSSPERIEIQYVLLVYEAEEFCNLVINESLLDHVFSVRSCYPSY TVCYLTNREQEVYKNLTKDNDWRRPPVEEVELLTENALDSNTLMTSGFSFMSCRIVDLQC IDEAELAEHIVGLTCSLSSCQFRKKLTRLDVNANGPLMIKDCVDRNIINKCTWLKALVAI PKVQPRFAIAIWKKYPTMKSLLSVYMDQNVSVHQKEFLLKDLITEGLLRDDRRVGEVCSK RVYRILVAQSGSIKTDDVEDGADLFRRQLA


| Top |