Cherry SNP DataBase

Gene information

Gene Pav_sc0002136.1_g090.1.mk
Chromosome name PAV_r1.0chr1
start 41768129
end 41772247
PAV_r1.0 name Pav_sc0002136.1
start 42205
end 46323
direction -
Annotation NR PREDICTED: charged multivesicular body protein 5-like
Sequence CDS ATGAAGAGGGTCTTCGGTGTCAAGAAAGAAAAAGAACCTCCGCCGTCTGTTGGAGATGCC TCCGAAAGGATTAATAAAAGAGGCGAAACAGTGGATGAGAAGATCAAGAAGCTTGATATT GAACTTAATAGATACAAAGAGCAGATCAAGAAGACAAGGCCTGGTCCTGCACAAGAAGCT GTCAAGTCTCGAGCCATGAGGGTTCTCAAGCAAAAGCGAATGTATGAAGGACAGCGTGAC ATGCTGTATAATCAGACATTTAACCTTGACCAAGTGGCCTTTGCCTCAGAGGGTATAAAA GATGCTCAGCAAACGATGACAGCTCTGAAATCTGCCAACAAGGAGCTAAAAGGAATGATG AAAACGGTGAAGATTCAAGATATTGATAATTTGCAAGATGAAATGATGGACCTAATGGAT GTAAGCAATGAAATTCAAGAAACCCTTGGTAGAAGCTATAATGTTCCTGATGACATTGAT GAGGAGGATCTTATGGGTGAGCTGGATGCTCTAGAAGCAGACATGGGTTTGGAAACTGAA GCCGATGGCGTTCCCTCCTATCTCCAACCTGATAAGGAATCTGATTTAGATGCAGAGCTC CACTTGCCTTCAGCACCCATAGGACATGCAGCAGCTCCAGCGGGCAGATCCAATGCCCAG GCTGAGGACGAATTGGGTTTACCAGCTGTCCCTAGGGCGTCACTTCGTGGTTAG
PEP MKRVFGVKKEKEPPPSVGDASERINKRGETVDEKIKKLDIELNRYKEQIKKTRPGPAQEA VKSRAMRVLKQKRMYEGQRDMLYNQTFNLDQVAFASEGIKDAQQTMTALKSANKELKGMM KTVKIQDIDNLQDEMMDLMDVSNEIQETLGRSYNVPDDIDEEDLMGELDALEADMGLETE ADGVPSYLQPDKESDLDAELHLPSAPIGHAAAPAGRSNAQAEDELGLPAVPRASLRG


| Top |