Cherry SNP DataBase

Gene information

Gene Pav_sc0002136.1_g320.1.mk
Chromosome name PAV_r1.0chr1
start 41883689
end 41886956
PAV_r1.0 name Pav_sc0002136.1
start 157765
end 161032
direction -
Annotation NR PREDICTED: elongation factor 1-gamma-like
Sequence CDS ATGGCTTTGGTGTTGCACGCGGGGAACACTAATAAAAATGGTTTCAAGGCACTTATTGCT GCCGAGTACACTGGTGTCAAAGTTGAACTGGTGAAGAATTTTGAGATGGGTGTGTCCAAC AAAAGTCCCAAGTTTCTTGAAATGAACCCCATCGGGAAGGTTCCTGTGTTAGAAACACCT GATGGCCCTGTTTTTGAGAGTAATGCCATTGCACGCTATGTTACTCGGTTGAAGGCAGAT AATCCTCTTTTTGGTTCTTCCTTAATTGAATATGCTCATGTGGAGCAATGGATTGATTTT GCCACTATGGAGATTGACGCCAATATTTTGCGATGGTTAATACCACGTATCGGTTTTGCT GTTTACCTTCCTCCGGCTGAGGAAGCTGCAATTTCTGCATTGAAGAGAGCGCTAACTGCT TTGAATACTCATCTTTCTTCCAACACGTACCTGGTCGGGCATTCTGTGACATTGGCTGAT ATCATTATGGCATGTAATTTGACTCTGGGATTTAGCCGGGTATTGACAAAAAAATTTACC TCTGAATTTCCCCATGTTGAGAGATACTTTTGGACCTTAGTTAATCAGCCAAATTTTCGC AAGATATTGGGCGAAGTTAAACAAGCAGAATCTGTTCCATCTATTCAGTCAGCAAAGAAG CCTTCACAGGCAAAGGAACCCACAAAACCTAAGGATGAACCAAAGAAAGAGGCCAAGAAA GAACCAGCAAAGCCTAAATTAGAAGAGGCTGTTGCTGAAGAAGAGGCACCCAAGCCCAGG GCAAAGAATCCTCTTGATCTTTTGCCGCCTAGCAAGATGATTCTGGATGAATGGAAAAGG CTTTATTCAAACACAAAGACCAACTTCCGTGAGGTTGCTGTTAAAGGATTCTGGGACATG TACGATCCAGAGGGTTACTCTCTTTGGTTCTGCGATTACAAGTACAATGATGAAAATACT GTATCATTTGTGACTTTGAACAAGGTGGGTGGTTTCCTGCAGCGGATGGATTTGGCTCGT AAGTATGCATTTGGGAAGATGTTGGTGATTGGCTCTGAGCCTCCATTTAAGGTTAAGGGC TTGTGGCTCTTCCGGGGACAAGAAATTCCAAAATTCATAATTGACGAGTGTTATGACATG GAATTGTACGACTGGCATAAGGTTGACATCACTGATGAGGATCAAAAGGAGCGTGTCAAT CAGATGATTGAAGATCAGGAGCCTTTTGAGGGGGAGGCTTTGTTGGATGCCAAATGTTTC AAGTGA
PEP MALVLHAGNTNKNGFKALIAAEYTGVKVELVKNFEMGVSNKSPKFLEMNPIGKVPVLETP DGPVFESNAIARYVTRLKADNPLFGSSLIEYAHVEQWIDFATMEIDANILRWLIPRIGFA VYLPPAEEAAISALKRALTALNTHLSSNTYLVGHSVTLADIIMACNLTLGFSRVLTKKFT SEFPHVERYFWTLVNQPNFRKILGEVKQAESVPSIQSAKKPSQAKEPTKPKDEPKKEAKK EPAKPKLEEAVAEEEAPKPRAKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAVKGFWDM YDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKG LWLFRGQEIPKFIIDECYDMELYDWHKVDITDEDQKERVNQMIEDQEPFEGEALLDAKCF K


| Top |