Cherry SNP DataBase

Gene information

Gene Pav_sc0002156.1_g100.1.mk
Chromosome name PAV_r1.0chr7
start 17807061
end 17812494
PAV_r1.0 name Pav_sc0002156.1
start 28928
end 34361
direction -
Annotation NR PREDICTED: proteinaceous RNase P 1, chloroplastic/mitochondrial-like
Sequence CDS ATGGCGTCCTATAAGGTTGTCTCTAGGTTATCGTCCCGATTACAACCCTTCACATGCAAT CTCAACAAGACGTCTCTTGCATCAGAACTCTCTCAGCTCAAATCGAGCCTTCACTCTCAG ACCTCCGCTCCCGCTCGACGCATTTCTCGCCTTTCCAGGTTACCGTCGGAGTTGGGTAGC GTGGGCTCAATGATGCCATTACACAGTGCAGTGGCTTCGGCACGGTTGATATCGAGCTTG TCCATCGAGTCTCAAAGCTGGGGTTTAGTTCCTCAAGCCGCAATGGATTTCAATGCCTTT ATGACAGCCTCTCTCCATATGAAGAGAGCGCTCTTCCAACGGCCACACATGGCCTCTTCT ACCTCCAACTCACTGCAGCAAAAGCACCACCTCCTCTCCATCAACCTCTGTAAGTTCCCA TCGGCTCTCAATTCTTTTAAATTCCATTGTCCATCTCATTTTCTCACTTACTCGCCTCCC AAACAAACACTTGAACTTAAACACACACTTCAACTTTATCCACTTCCAGTAGTTAGAGAA AATATTAGCCACATAGTTGCAAAGTTATCTACCACGTACCGTGAACCATATATAAAAACC AAGACTTCAGGGGCTGGTACTGAGTTTTCTTCCTTAAAGTCCACAGAAGAAAGGGTTGGC AAAAAATCTGTAAAGAACCATGTTGATTCAGTGGAGGAGAAAAAGGCTGAAGATAGGTTC AGTAAAGACAGAAATACGAGGAAAAATCCTGGCTTTAGAAAAAGGAGGGACGATAATGGG CATTCTTCTAGGAGGCTCAAAGATGAGAATAAAGTAAACTCCTCAGGAAAACGTAATGAT AAACAGGCGGGTGAAGAGAAAAGGGGGAAAGGGTCTAAGAAATATGACGTTGATGCGCCA GAAGTTAAGATGAGAGTTGGGTTGGATATGTGCTCAAAGAGAGGGGATGTCATGGGGGCA ATTAAATTCTATGATTTGGCTCAAAGAGAAGAAATTAAGTTGGAGCAGTACCACTATACA GTACTGTTGTATCTCTGTTCTTCTGCAGCTGTTGGTGTTGTTCGTCCCGCTAAGAGTGGG TCTGGTAGTCGAACTTTGGATACCTTGGATTCGTCTGCCAGCGAAGAAACCAGGGTGAAT TCCATGGAATTGGGTAGTGGGAATTGGGATGGTGGGGGGTTGAATACATCAACTTTGGAC AATGAGCAGCTGGTTGATACCAATGGAAGTAATGGGGACAAAATGGGGTTTGATGATCTG GATGGTACTTCAGATGAAAAGGAGAACTTGGCATGGTTTTCTAATGGGTTTGTGAAGCGA AATTCCCGCCTCTTAGATGGACTGAACTACCCTACAAAGGGTGGAGATGATTCGTCAAAT CTAAAAGATGGAAGCATTAAGCAAGAAGATAATGGAATTCGTGTTAGTGAAGAAGTGAAG AAGTATGCCCTCCGAAGGGGATTTGAGATCTATGAGAAGATGTGTTTGGATAATGTCCCA ATGAATGAGGCAGCATTGACATCTGTGGCTAGAATGGCAATGTCAATGGGTGATGGAGAC ATGGCATTTGATATGGTGAAGCAAATGAAGTCATTGGGAATAAATCCTAGACTGCGTTCC TATGGTCCTGCATTATCTGCTTTTTGCCATAGTGGAGATATTGAGAAAGCATTTGCTGTT GAGAAACACATGTTGGAGCATGGTGTCTATCCAGAGGAGCCTGAACTAGAGGCCCTCTTA CGAGTGAGTGTGGGAGTTGGTAAAGGTGACAAGGTGTATTATATGCTGCACAAACTAAGA ACAAGTGTAAGGAGGGTCTCACCGTCTACTGCCGATTTAATTATGAACTGGTTTCATAGC AAAGAAGCTGCAAGAGTGGGAAAAATAAAATGGGATCCAAGATTGACGAGGGATGCAATT GAGAATGGAGGTGGGGGCTGGCATGGGCAGGGCTGGTTGGGAAAAGGAAAATGGTCTGTG TTGCGTACAACTATTGGAGCTGATGGCTTGTGCAAATGCTGTGGGGAAAAATTGGCCACA ATTGACCTTGATCCTGTAGAAACAGAAAATTTTGCTGAATCAGTTGCATCTATAGCTATA AAGAGAGAGAAAAATTCAAGCTTTCAGAAATTCCAAGTCAATGCTGTTGTTAATGGAATA CGCCAGAAGTTTCCTTCAAAGAGATGGCCACTCGTTGTTCTTCATAACAGGCGTATCAGT GGAGGAAAAATGGATGAACGGGTTAATAGGGCATTGATTGAGAAGTGGCAAAATGCTGAT GCTCTCTATGCAACACCTACGGGTTCAAATGATGATTGGTACTGGTTGTATGCAGCTATA AAGTTCAAATGTTTATTGGTGACAAATGACGAAATGAGAGACCATATATTTCAACTTCTC GGAAATGATTTCTTCCCCAGATGGAAAGAAAGGCATCAAGTGCATTTCAGTTTTTCTGAT GCTGGTCCAGTGTTTCACATGCCTCCTCCATGTTCTGTTGTAATTCAGGAATCAGAGGAA GGGCACTGGCATATTCCAGTTGCATCAGAACATGATTGTGAGGCAGAAAGAACATGGTTA TGCATTATGCGAAGTAAATCACGTCTGGAAAGGAACGATTCTGCAACCAGACCTGAAGCT TACCAAGAAGATTTGTGTGGAGCAGTTGCACAGCCTCTTCGTCGTGACAACGGGAATGCA AGGTCAGCTACTCAAACTGGTGTTGAGTCACAACCATTGAAGAATGGCAAGCAGAAATAT ACTAAACACCAGCCTAATGAATTTTTTGAGAATCTCAAAGATATTCTGTCAGGGTCCATG ATCTCAGATTGTCACTCAATTGTTCCAGATATTGCAACTGCAGAGAAGATTGGTGGATGT GTCATTGATTTTCAAATATAA
PEP MASYKVVSRLSSRLQPFTCNLNKTSLASELSQLKSSLHSQTSAPARRISRLSRLPSELGS VGSMMPLHSAVASARLISSLSIESQSWGLVPQAAMDFNAFMTASLHMKRALFQRPHMASS TSNSLQQKHHLLSINLCKFPSALNSFKFHCPSHFLTYSPPKQTLELKHTLQLYPLPVVRE NISHIVAKLSTTYREPYIKTKTSGAGTEFSSLKSTEERVGKKSVKNHVDSVEEKKAEDRF SKDRNTRKNPGFRKRRDDNGHSSRRLKDENKVNSSGKRNDKQAGEEKRGKGSKKYDVDAP EVKMRVGLDMCSKRGDVMGAIKFYDLAQREEIKLEQYHYTVLLYLCSSAAVGVVRPAKSG SGSRTLDTLDSSASEETRVNSMELGSGNWDGGGLNTSTLDNEQLVDTNGSNGDKMGFDDL DGTSDEKENLAWFSNGFVKRNSRLLDGLNYPTKGGDDSSNLKDGSIKQEDNGIRVSEEVK KYALRRGFEIYEKMCLDNVPMNEAALTSVARMAMSMGDGDMAFDMVKQMKSLGINPRLRS YGPALSAFCHSGDIEKAFAVEKHMLEHGVYPEEPELEALLRVSVGVGKGDKVYYMLHKLR TSVRRVSPSTADLIMNWFHSKEAARVGKIKWDPRLTRDAIENGGGGWHGQGWLGKGKWSV LRTTIGADGLCKCCGEKLATIDLDPVETENFAESVASIAIKREKNSSFQKFQVNAVVNGI RQKFPSKRWPLVVLHNRRISGGKMDERVNRALIEKWQNADALYATPTGSNDDWYWLYAAI KFKCLLVTNDEMRDHIFQLLGNDFFPRWKERHQVHFSFSDAGPVFHMPPPCSVVIQESEE GHWHIPVASEHDCEAERTWLCIMRSKSRLERNDSATRPEAYQEDLCGAVAQPLRRDNGNA RSATQTGVESQPLKNGKQKYTKHQPNEFFENLKDILSGSMISDCHSIVPDIATAEKIGGC VIDFQI


| Top |