Cherry SNP DataBase

Gene information

Gene Pav_sc0002179.1_g110.1.br
Chromosome name PAV_r1.0chr1
start 11561455
end 11567733
PAV_r1.0 name Pav_sc0002179.1
start 83102
end 89380
direction -
Annotation NR PREDICTED: protein PRD1
Sequence CDS ATGTACTTCGACGACTCACAGTCGCAGCAGCTCCTCCGAGACTACAATGAAAATGAAGAA GAAGAAGCTTCGAATTCCGTTGTGTCACCGAGAACGTGCTCAGAGGGCCACAGATCCACG CTCTTGCTCCGAACCAAGCAAGGCGGCTCCATCTGCTTGCTCTGCTTCTCCAACCTCATC TCCAACCCCCAATCCTCCACCGTCCACGTGTCCTACGCCCTCTCTCAGCTCTCTCAGGCC ATCTCCTCCGACCCCCCCTTCCTCCGCTCTCTCGTCGACTTCCATCCTCACTTCCTCGTC TCGCCTCTCGTTCATGCTCTCTCTTCCTTCGACGACGACCCCATCGCACGACAAGTCGTC CATCTCATTTCCGCTCTCTGCGAATCTTCCGGTGCCTCGATCTCTGCTGACTTCGTCGCT AGGGTTTCCGACCGCCTCTCATCTGGTGCCTTGGCCTGGAGTCGCCGTCAGCTTTATACG CTTCACTGCTTAGGGGTTTTGTTAAACTGCCAGCAGAATAATCCTTACGCTCACATTAGA GACAAATATGGTCTCATTACCAATCTTGTTGAAGGTCTTCAATTGCCAAGTGAAGAGATT CGGGGAGAAATCCTGTTTGTTCTATACAAGGTATCCGTTCTCCAATACGCATCAGAGGTT GGTGATGGAACTGATTTTTTATTTGCCTTTTGCCCCAAGCTATTGCGCTTGTCTCTAGAG GCCCTCATGAAGACCCAAAGCGATGATGTCCGCTTGAATTGTGTAGCATTCTTGACAGTG TTGGCTCTGAGAGGGCTTTTCGGGGCTGCATATGCAGTTGATATAAACAGCATGAGTTCG TCCGAAGGAGATAGCTTTGAGCAAGCAACAGAAGATGGAAAAGATGCAAATCCAATGAAT ATATTGTTTACGGAAGCCATCAAAGGCCCAATGCTTTCAACAGACAGCCAAGTCCAGATC AGCACACTTGATTTACTGTTTCATTACATGTCCTCCTGGGAAGGCACTTCAGGCAAAGAA GCCCAATTCCTAGTGGAAGAGAACATTGCAGATTATGTATTTGAAATACTAAGATTGTCA GAATGCAAGGATCCAGTGGTCAAATCTTGTGTTCAGGTACTTGACATTTTATCAAAAGCT GAGCAAGCTTTCAAACAGAGGCTTGTTGTTGGGTTTGCAACTTTGGTTCCAGTACTAAAT TATGTAGCTGACATTCCTTTCCATCCAGTTCAAAATCAGACATTAAAACTCATTCTGAAC TGCATATCTGATTGCCCTGGAATGGTATCCTCCTCTCATATAACAGAGCTAGTACCTGTT CTAGCAAAGATGCTTAAAAAGCATTCTGATGGGGAGATAGGCATGCTTGAGGAGACATTT ATATTGACCTGCTCAGTTGTTGTAGCTATTGTCAGAACTCCATCTGTTCATGGGAATTTG AATCTACAAATTTCAATTAAAGAAGCAATGCAACATGCTGTATCAGCTTGTCTAAGTATC TCGGAGAAGAATCCTTGTAAACTTTTGCATTCCTTGTTCCTACTTAAGGAGGTGTATAAT ATTTATAGTCGTGAAGGAAATTCTACTGACTCCACTAAAGCGGAACTACGACAATTTATT GTAAATGTATGTACAAAACATTTGTTACCTTGGCTTGGAACCAACTTCAATGAAATGGAT GAGGAAACTGTCCTTGGAGTATTGGAAACATTTCATTCGATACTGCTTCAGGATTCCAAT AATCAAGTAGCAGAACTCGCAGAGAACCTAGTTTCAAGCAGTTGGTTCAGTTTGTCGTTT GGATGCCTAGGTTTATTTCCCACAGAAAAGATGAAATGGAGAGTGTATCTGATGCTCAGT TCACTGGTAGATGTTCTTGTGGGAAATGATTCTGGGCAACCTATTAGAGATGCTACTTTA TGTCTCCCATCTGATCCCATTGATTTGCTCTTTCTACTTGGGCAAAAGAACTCCCGTAAT CTGGAATTATCTTCTTGCCAATCTGCCATTTTGCTGATTTTATACACCAGTTCTTTATAT GATGAAAGACTTGCAGATGATAAGTTGGTTTTAGCTTCTCTAGAGCAATATATTCTGGTC AACATGGAAAGAACAGTCATATGCACAATTCATGAAGCATGTCTAAAAGGACCAGCATTG GTTGACCACGATGAGGAAACAAGCTCTGGAGAAGTTTTAATATTTGTGCTTCTACTAAAC TTCTTCTCCTTAAGAAGTTTGCACACTGTTTTACCAGGGATTGTGGACTGGAAAAATTTC TTTGATCCCCCAGATAGGTTACAGCAGATTTCCTTTATCCGGATATTCTGCCATGACCTA TGCAGACTATTACATTTTGGATCACCTTTGGTCAAACTTGTTGCTTCATACTGCCTATTG GAGTTGTTTACCCGAATATCTGATCAGAGGAATAGAACAGGGGAGGAGTTGGTATGCACC ATGGACTACCTAATGTCTGTAATGGCTGTCCTAGAAGGCTTAATTTTCTACAGTGACCTC AGAGTGGCTATGAATTGTGGCCTCTGCCTATCAATGATCTTGGGTTGGGAATTGCCGGGA ATGCAAGGAACAATTGTGATTACAAGGAATCATTGGAGTAGGATGATTGTGGAAGAGCTG GCAATGTCTTTAGCAGTCCCATGCTTAGCATCAAAATCTTTCATTAATCTTCACAAGCCT GCAATTCATGTAGCAGTCACATTGTTAAAGCTGCCGAAGGTTCCTGAATGGATGAGATCG GTGTTTGATGATTCTTGCATATCTGGCATCATTCAAAACCTTGCAGCAAATAATTTGAGC ACAGAGATTGTACTTTTATTTCGAGCTCTATTGAACTCTGAGTACTTAAAGGCGGAACAA ATTTGTAGTGTAAATCAGCTGCTCCAGGCCTGCAGAAAACAGAAGTACACTGACAACAGT CAAGATGAAAGTGCAAAAGAGCATAAAAAAAAGGCAGTCGCCATCCTGGACGACATGGGA GAAGTTTGTGAGTATCTCATTCACTTGATGTCATCCAAGTCTTGTCTAGACAGGGATTCT GGAGGATTAAATTTTGGGGATAAGAGATTGTTAGAAGAAATAGAGCTTTTCTTTAAAACT TCAACAGTAACATAG
PEP MYFDDSQSQQLLRDYNENEEEEASNSVVSPRTCSEGHRSTLLLRTKQGGSICLLCFSNLI SNPQSSTVHVSYALSQLSQAISSDPPFLRSLVDFHPHFLVSPLVHALSSFDDDPIARQVV HLISALCESSGASISADFVARVSDRLSSGALAWSRRQLYTLHCLGVLLNCQQNNPYAHIR DKYGLITNLVEGLQLPSEEIRGEILFVLYKVSVLQYASEVGDGTDFLFAFCPKLLRLSLE ALMKTQSDDVRLNCVAFLTVLALRGLFGAAYAVDINSMSSSEGDSFEQATEDGKDANPMN ILFTEAIKGPMLSTDSQVQISTLDLLFHYMSSWEGTSGKEAQFLVEENIADYVFEILRLS ECKDPVVKSCVQVLDILSKAEQAFKQRLVVGFATLVPVLNYVADIPFHPVQNQTLKLILN CISDCPGMVSSSHITELVPVLAKMLKKHSDGEIGMLEETFILTCSVVVAIVRTPSVHGNL NLQISIKEAMQHAVSACLSISEKNPCKLLHSLFLLKEVYNIYSREGNSTDSTKAELRQFI VNVCTKHLLPWLGTNFNEMDEETVLGVLETFHSILLQDSNNQVAELAENLVSSSWFSLSF GCLGLFPTEKMKWRVYLMLSSLVDVLVGNDSGQPIRDATLCLPSDPIDLLFLLGQKNSRN LELSSCQSAILLILYTSSLYDERLADDKLVLASLEQYILVNMERTVICTIHEACLKGPAL VDHDEETSSGEVLIFVLLLNFFSLRSLHTVLPGIVDWKNFFDPPDRLQQISFIRIFCHDL CRLLHFGSPLVKLVASYCLLELFTRISDQRNRTGEELVCTMDYLMSVMAVLEGLIFYSDL RVAMNCGLCLSMILGWELPGMQGTIVITRNHWSRMIVEELAMSLAVPCLASKSFINLHKP AIHVAVTLLKLPKVPEWMRSVFDDSCISGIIQNLAANNLSTEIVLLFRALLNSEYLKAEQ ICSVNQLLQACRKQKYTDNSQDESAKEHKKKAVAILDDMGEVCEYLIHLMSSKSCLDRDS GGLNFGDKRLLEEIELFFKTSTVT


| Top |