Cherry SNP DataBase

Gene information

Gene Pav_sc0002197.1_g010.1.mk
Chromosome name PAV_r1.0chr6
start 17286822
end 17290771
PAV_r1.0 name Pav_sc0002197.1
start 3461
end 7410
direction -
Annotation NR PREDICTED: probable pectate lyase 4
Sequence CDS ATGGGCAACTCCCACGGCCACCGTAAACGCCGTAACGGCCCCGTCTCCAGTAGAACGGAC AATTCGGGCTTTAAATATGGTCCGTCGGATCAATCAGCCCAAATCCCGAGCTCGTCAGCT AAGAACACCAGCATGGTGGCCTTGCCGTACGCTCATGTCGACGCGAGCTTGCGAGCCCTC GCTGCCCAGGCCGAAGGCTTCGGCCGCCTCGCAATTGGTGGCCTCCGCGGTGCCCTTTAC CACGTCACCACTCTAGCTGATGATGGTCCTGGGTCACTTAGGGACGGATGTCGTAGGAAA GAACCACTTTGGATTGTCTTTGAAATTTCAGGCACTATCCTTCTGTCATCTTACTTGAAT GTGTCATCGTATAAGACTATAGATGGCCGGAGTCAGAGGATTAAACTTACAGGGAAGGGG TTGAGGCTGAAGGAATGTGAGCATGTGATTGTATGCAATTTAGAGTTTGAAGGTGGTAGA GGGCCAGATGTTGATGGCATTCAAATAAAACCCAATTCCAAGCACATATGGATAGATCGG TGCAGCCTTCGTGATTATGATGACGGGCTCATAGATATCACCAGGGGAAGCACAGATATT ACAATTTCGAGATTTGCGAAAGTTCATCTATATAACAATTACACCCGAAACTGGGGCATA TATGCTGTTTGTGCCAGTGTAGAATCGCAGATATTCTCTGAATGCAATATATATGAAGCG GGACAGAAGAAAGTGGCATTTAAGTACCTTACGGAGAAGGCAGCGGACAAGGAGGTGGCA ATGACTGGCCACATTAAGTCTGAAAGGGACTTATTTATAACTGGAACTCAAGCTGGATTA ACGCCCGTGGGTGTCGAACACAGCATGTTTCATCCTAGCCAACACTATCGGACATATACG GTAGGACCTCCCACTGATGATCTTAAACATGTTCTACAACATTGTACAGGATGGCAGTCT GTTCCACGGCCAGCTGATCAGACAGGAGTAGCATAG
PEP MGNSHGHRKRRNGPVSSRTDNSGFKYGPSDQSAQIPSSSAKNTSMVALPYAHVDASLRAL AAQAEGFGRLAIGGLRGALYHVTTLADDGPGSLRDGCRRKEPLWIVFEISGTILLSSYLN VSSYKTIDGRSQRIKLTGKGLRLKECEHVIVCNLEFEGGRGPDVDGIQIKPNSKHIWIDR CSLRDYDDGLIDITRGSTDITISRFAKVHLYNNYTRNWGIYAVCASVESQIFSECNIYEA GQKKVAFKYLTEKAADKEVAMTGHIKSERDLFITGTQAGLTPVGVEHSMFHPSQHYRTYT VGPPTDDLKHVLQHCTGWQSVPRPADQTGVA


| Top |