Cherry SNP DataBase

Gene information

Gene Pav_sc0002197.1_g060.1.mk
Chromosome name PAV_r1.0chr6
start 17261172
end 17269229
PAV_r1.0 name Pav_sc0002197.1
start 25003
end 33060
direction -
Annotation NR PREDICTED: MAR-binding filament-like protein 1
Sequence CDS ATGTCGTGGATAAGAAATGCGGTGAACCTGGCAGTGGAAGCAGGGGCTACCAATAGCCTC ACTCGCACCGTACGGAACTACGCCGACTCTGTCGTCCTTCACGCCGGGAATGCCGTCGCC GGCGGAGCCAGACTCCTCCTCCCTGAACGCATTGGCCCTAGGAATTTACAGAGTTTTAGG CATACTGTGAAAAGATTGGAAGAGGTGTCTGTTTCCTGTAGAGGGGTAGAAAGGGTTCAG CTACTGAGGAGGTGGTTGGTTGCACTTAAAGAAATAGAGAGATTGTCCACCCTTTACAAT GTGAACAATGAAAAAACCCCTGATGACCAACTTAACTTTGATGAATCCATGGAATCGCCA AAAATACCTACGCTGGTTTATTACATTGACTCTGATATGGGAGATGAACCAAAAACTTTT CGCGATGTCTTTCTACATAGCCAAGCTCTTGAAGGCATAACATTATCAATGATTCTTGAA GAACCAAATGAGGAAGAAGTTTCGCTACTTTTGGAGATATATAGGCTCTGCCTTACAGGA GGAAAGGAGGTACATAATGTAGTAATGAGCAGTGTACAGAATTTGGCAGCAGCACTTTCA TACTATCAAGATGAAGTACTGATAAAACGAGAAGAATTGCTCCAATTTGCTCAAGGTGCA ATTGCAGGGCTGAAAATAAATGCTGATCTTGCAAGAATAGATGCTGAAGCCTGCAGTATA AGGGAAGAACTTGATAAAGTGATGGCACACCAAAAGCCTCTAAGTGAAGGTTGTGAAAAA TCATCTGAGAAGGAAAGGGATGCAACAATAGAGAATTTAAAAGAAGCACTTGTCGAAATT CAACTATGTTCCAGGTTGGAGGATCTGTTATTAAAGAAGAAATCCTTGAGCAATGGGGAC TCGCCCGAGATGCATTGTGAAAAGGTTGAAAAATTAAAAGTATTTTCAGAATCTCTTGCT AACTCCACCTCTCAAGCTGAAAAGCGCATTTTAGACCACAGGTTTCAGAAAGAAGAAGCA CTCAACTTTCGTGTAGCTAAAGCTAATGAAGTAAGCCAACAGGAGAAGGAATTGGTGGCA GAGATCGGACAACTTGAGAGGCAAAGAGAAGAACTCCAACAAGAACTGAAAAAGGTGATT ATTTCATTGAAGGCCGTTCGTGCACGCCTTCACAATGCAAGGGAAGAAAGAGAACAGTTT GATGAAGCAAGCAATCAGATTCTTGTACACATAAAATCAAAGGAAGATGAGCTGTCAAGA TCCATTGCTTCATGTAAAACAGAAGTTGATGTTGTCAATACTTGGATTAGTTTTTTGGAA GATACATGGGTTCTCCAGACCTCATACACAGAGAAAAAGGAGAAGCAGGTCAATGGTGAA CTGGAGAGATATGGAGACCATTTTGTGAATTTGGTAATCCAACTTCTCTCTACCTACAAG GAAAGCTTGGGATCATCCATCGTTCATATTAAGAATCTCGTGGAGAGCTTGAGGTCAAGT CAAGGAGCAAATATATCACCTCATATAGATGATGGAAGTTCAAAAGTAAATAACCCAAGA AAAAATCTTGAAGAGGAATATTTGGACATGGAAGCAAAGGTATGCACACATTTTCCACTG AGAGATGACCAGAAGGTCAAAGACCTCTTTGATGCCCTCAAAAAAATAAAAGATGAATTT GAATCCATTGACAGACCGACATTGGAAATCGAAGCTTCACCACAAAGACCAGAGACACCG TCTAGTGATGGGCCCCAAATAATTCCATCTCCTACCTCTACCTCTCCATTGACAGCCTCT CCATTGACCAACTTTCCATTGATCGCTGGACCTCCAGAACTCAAACTGGATGAAGTATCC AATTCTTCCTTGATTAAAGGGGAGAAGAAGACAGTAGACTCAAAAGAAGAATTGGCAAAA GTAGAACCAGAACATGGTAAGGCCCTTCCATTGACCACTGGGACTCCAGAACTCAAACAG GATAAAGGATCCAATTCTTCCTTGATTAAGGGAGACAAGACACTAAACCCAAAAGAAGAA TTGGCAAAACTAGAGCCAGAACATGGGAAGGTTGGCAAAGAAGGCTCAACAGAGGAGATT AATGACTGGGGGTTTGATGAACTTGAAAAGGACCTAAAAACCCCTAGCTGA
PEP MSWIRNAVNLAVEAGATNSLTRTVRNYADSVVLHAGNAVAGGARLLLPERIGPRNLQSFR HTVKRLEEVSVSCRGVERVQLLRRWLVALKEIERLSTLYNVNNEKTPDDQLNFDESMESP KIPTLVYYIDSDMGDEPKTFRDVFLHSQALEGITLSMILEEPNEEEVSLLLEIYRLCLTG GKEVHNVVMSSVQNLAAALSYYQDEVLIKREELLQFAQGAIAGLKINADLARIDAEACSI REELDKVMAHQKPLSEGCEKSSEKERDATIENLKEALVEIQLCSRLEDLLLKKKSLSNGD SPEMHCEKVEKLKVFSESLANSTSQAEKRILDHRFQKEEALNFRVAKANEVSQQEKELVA EIGQLERQREELQQELKKVIISLKAVRARLHNAREEREQFDEASNQILVHIKSKEDELSR SIASCKTEVDVVNTWISFLEDTWVLQTSYTEKKEKQVNGELERYGDHFVNLVIQLLSTYK ESLGSSIVHIKNLVESLRSSQGANISPHIDDGSSKVNNPRKNLEEEYLDMEAKVCTHFPL RDDQKVKDLFDALKKIKDEFESIDRPTLEIEASPQRPETPSSDGPQIIPSPTSTSPLTAS PLTNFPLIAGPPELKLDEVSNSSLIKGEKKTVDSKEELAKVEPEHGKALPLTTGTPELKQ DKGSNSSLIKGDKTLNPKEELAKLEPEHGKVGKEGSTEEINDWGFDELEKDLKTPS


| Top |