Cherry SNP DataBase

Gene information

Gene Pav_sc0002197.1_g140.1.mk
Chromosome name PAV_r1.0chr6
start 17214548
end 17215514
PAV_r1.0 name Pav_sc0002197.1
start 78718
end 79684
direction -
Annotation NR PREDICTED: U4/U6.U5 tri-snRNP-associated protein 2-like
Sequence CDS ATGAACTCTAAGAGGGAACATGAAGATAATGTTAGAGTGAACGCGGAAGAGTTTGAATCT GACCCAAAGAGGCAAAAACAGAATGGACATTCATCTCCTTCCTCTTCACCACCTCCACCT GCCTCTGAGGATGACGAGGACAACCAGAGAAGGCCACCTGTTGATGGCTATAGAGGGGAT GATGGTGATAATCAAAGGGATCTAAAAAGTGGGGTTGACGTTGAAGTAGAAGAAGAAGAT GATGATGATGATGATCTTGAACAAGGACTTTACAGGCGGAGCCTTGAAATTGAGGTCGGG AGGGATTGCCCATATCTTGACGCTGTTAATCGCCAGTATGTGGCAACTATTACCAAGGAA AAGGGAACGAGTCCCTTGCATATACTCATAGCCTTGAAGCTGGACACCATGTATGACATT AGACATGTCCTGAACCCGAGGTTTATGGAGGAACAAGTTGAGCAGATTGACAAAAACAGG CAATACTCTAGGGCACTTGATGGTTCTTATTACCTTCCTGGAATGTTGGGGCTCAATAAC AATAAGGAGACTGATTTTGTCAATGTCAACATTCAATCTTTAATGAGAGTCACTCCACTA AGAAACTTTTTCCTCATCCCTAAGAATTATCAACATTGCAAGTCTCCACTTGTTCATCGA TTCAGGGAGCTCACGAGAAAGATATGGCATGCACCCAACTTCGAAGGACAGGTGAGCCCG CATGAGTTCCTGCAGGCAGTTATGAAAGCCAGTAAGAAACGGTTTCGAATAGGAGAGCAA TCTGACCCTGTTGAATTCATCTCATGGCTGCTTAATACACTGCATGCACATCTTACAACT TCAAAGAAAGATAGCAGCAGCATCTATGAGTGCTTTCAGGGGAATTGGAGGTTGTGA
PEP MNSKREHEDNVRVNAEEFESDPKRQKQNGHSSPSSSPPPPASEDDEDNQRRPPVDGYRGD DGDNQRDLKSGVDVEVEEEDDDDDDLEQGLYRRSLEIEVGRDCPYLDAVNRQYVATITKE KGTSPLHILIALKLDTMYDIRHVLNPRFMEEQVEQIDKNRQYSRALDGSYYLPGMLGLNN NKETDFVNVNIQSLMRVTPLRNFFLIPKNYQHCKSPLVHRFRELTRKIWHAPNFEGQVSP HEFLQAVMKASKKRFRIGEQSDPVEFISWLLNTLHAHLTTSKKDSSSIYECFQGNWRL


| Top |