Cherry SNP DataBase

Gene information

Gene Pav_sc0002208.1_g150.1.mk
Chromosome name PAV_r1.0chr1
start 28368180
end 28381230
PAV_r1.0 name Pav_sc0002208.1
start 62801
end 75851
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103321302
Sequence CDS ATGGGCAGTCAAGCCATGAGCGCTCTTGTTCCATTCTCTCCTTGGATTCCCGAGGATGAT ATTTTGCTCAAGAACGCGGTTGAGGCTGGTGCTTCTTTGGAGTCACTTGCTAAAGGGGCA GTGCATTTTTCTCGAAGATTTACTATTCGTGAACTGCAAGATCGGTGGTATTCTCTCCTA TATGATCCGGTTGTTTCTGCCAACGCTTCTGCTCGCATGGTTGAGTTCGAGTGTTCCACT CCAACTCTCCCTATAGATAGACCGGGAAATTCAAAAGAAAACAAATGTGAATCTGGAAAG AGAAAAGCTGAAAGTGTTCGCAGTTGTTACTATGCTCTGCGTAAAAGGATCTGCAATGAG CCATTTAACTCCATGGGCCTTAATTTTCTTGTTCAACCCAGTAATATTAATTATGTTGGA AATGAAGATGAGCCTCTTTATGGAAATTGCATGACTGGAGATCCGACCCCTATTGGCCTT GAGAGGTCAGATATGGATACTCTTCAAAATCTGATGGATGGTGGTACTGCCACTGGCGGT GTAGTTACTGCTGATACCTTTAATACAGGACTCCAGATTCCAGCCGAAAGTGATTTTCAT ATGGAACAGGATAATATACATAAAGAAGTTCCTCACATTCTTGGAGACAATATGCCCTTC AGACGGAATGGATCTGAGGTGGAGGAATTCAATCAGCCAAAGGAATTGCCAGAGTGCAGC TTGTTCAATGCTGATGACTTAGGAATGGAACCTCCGTATACACTTGATCAAAGTAATGGT GACGATGGAAATATGTGCACAAAGTTTGAAGGGAATCAAACCTTTAATTCATCCGTTTCA GACAATGGTGCATCGTTTCACAACTTGGAGTATTCATCTCCACTTCCTGGGATGCCTATC TGGAGAACAGGTGCAGAACCGGCTATGCCAGTTGATGTCGATGTTGGTCTTGGGGAAAAT GATCTATGCACCAGCGATACTTTTGAACTTCCTGATGATATTGATGCTAACAACACAAGA ACATCAGAGTATGATGTTCAACTGGGGATGGAGGTGAAAGCTGACATGCCATGTGGTGAT TTCAAGAGTGCAGCAGCTCCTGCGAGTACTGAAGGTTATTTGGCAGAATTGTCCAATTCA CTTTTAAACTTTACTAATGAGGAGCTCATGCTCATGACTGCTGATGGAAAAGACGTGATT GATAAGTCTTACTATGATGGCCTGAGCTCACTTTTGTTGAGTTCACCAAATGATGATGCT CGTCAAGAACAGACAATTGATATAACTGAGCCAGAAACATCTGTAGCTCCAGTGATGTAT TCCATGAATCCATCAAGTTCGGATCCTGGAGTGGTAGATGACACTAAGGGGTCCCAAAAT GCTGATGAACATATGGCTTGTCATTCGGAGACTCTGATGCAATCATCTTCAACAGCTTCA AACTATCAATATCCTGAACTGAAAGATGGAGTTATCTGCTGCACATTAAACACCGAGGAC TTGGAAATTCCATGCAATGATGATGTTTTTATACCAAATCATGTTCTCCAGTCATCAACT TTCTCTGAAGTAGAATGGGATTTGCAAGAAGTGAATAAGCTAATATCTTCATCCAGTAAT GATTTACCTGTCAATCAAAGAAATAGTGACACAGGGCCATGCTTTATGCGCACAGAGAAA AAAAAACCTGGAGAACCTCATAGGTCTTCTCCAATTAAAGGATCACACCACTTACAAGAA ATGGATCCAAAACCTCCACTGGATAATTTTGGGGTTAAATTTGAGCTGTCCAAGACTGAC CCCAGCGAAGTGGCTTCTAAGAATCCAGGTCATGTGAGTGAAGGTCTAGGTCAGATTTAT TCAGCCAATCCAAATACAAATCCTGTACCTGGAATTCTGGAGACTAGACAAAGTATATTG GCAAAGCGCCTCAGCTATAAGTCAACTGAGCTTCGTATGGAGAAGCCAGATCTTGATTAT AATAGTTTTAAAAGCTATCCTCAGACAAATGCTCGTGTCAGTAAACAGGAGCTTGATCCA ACTGCTACAAGTAGAGATCATAAAACATTACATGCAGAAGTGATGCCTGAGCATAATGCT GTCTCAGAACCAGAATTAAGCCCACGGACGTCAGATCAACTGGGGCTTTTTGAGAGTGAT GATGATGTACCATGTTATTCGGATATAGAGGCAATGATACTTGATATGGATTTGGATCCA GATGACCAGGACTTGTATTCTCGTGAGGACGTCTCAAGATATCAGCATGAGGACACTAAG AGGAGAATCATAAGGCTGGAGCAGGGTGCTTATTCGTATTTGCAAAGAGCCATTGCATCT CATGGAGCATTTGCCATTTTGTATGGGCGTCATTCTAAGCATTATATTAAGAAGCCAGAG GTTTTATTGGGTAGAGCAACTGAAGATGCGATTGTTGACATTGACTTGGGAAGAGAAGGA CGTGGTAATAAAATCTCTCGACAACAGGCAATGATAAAGATGGACAAAGGCGGATATTTC TATCTGAAAAATCTTGGGAAGTGTTCAATCTCAGTAAATAGCAAGGAAGTAGCCCCTGGA CAGAGTCTAAGCCTTAGTTCGAGCTGCTTGATTGAGATTAGGGGAATGCCGTTCATATTT GAGACGAACCAAACTCGTGTGAAGCAGTATATGGATAGCATGACCAAGGTTAGCTCAAAG CAAGAGGGAGGAGAGAGAGATAGAGGACCATAG
PEP MGSQAMSALVPFSPWIPEDDILLKNAVEAGASLESLAKGAVHFSRRFTIRELQDRWYSLL YDPVVSANASARMVEFECSTPTLPIDRPGNSKENKCESGKRKAESVRSCYYALRKRICNE PFNSMGLNFLVQPSNINYVGNEDEPLYGNCMTGDPTPIGLERSDMDTLQNLMDGGTATGG VVTADTFNTGLQIPAESDFHMEQDNIHKEVPHILGDNMPFRRNGSEVEEFNQPKELPECS LFNADDLGMEPPYTLDQSNGDDGNMCTKFEGNQTFNSSVSDNGASFHNLEYSSPLPGMPI WRTGAEPAMPVDVDVGLGENDLCTSDTFELPDDIDANNTRTSEYDVQLGMEVKADMPCGD FKSAAAPASTEGYLAELSNSLLNFTNEELMLMTADGKDVIDKSYYDGLSSLLLSSPNDDA RQEQTIDITEPETSVAPVMYSMNPSSSDPGVVDDTKGSQNADEHMACHSETLMQSSSTAS NYQYPELKDGVICCTLNTEDLEIPCNDDVFIPNHVLQSSTFSEVEWDLQEVNKLISSSSN DLPVNQRNSDTGPCFMRTEKKKPGEPHRSSPIKGSHHLQEMDPKPPLDNFGVKFELSKTD PSEVASKNPGHVSEGLGQIYSANPNTNPVPGILETRQSILAKRLSYKSTELRMEKPDLDY NSFKSYPQTNARVSKQELDPTATSRDHKTLHAEVMPEHNAVSEPELSPRTSDQLGLFESD DDVPCYSDIEAMILDMDLDPDDQDLYSREDVSRYQHEDTKRRIIRLEQGAYSYLQRAIAS HGAFAILYGRHSKHYIKKPEVLLGRATEDAIVDIDLGREGRGNKISRQQAMIKMDKGGYF YLKNLGKCSISVNSKEVAPGQSLSLSSSCLIEIRGMPFIFETNQTRVKQYMDSMTKVSSK QEGGERDRGP


| Top |