Cherry SNP DataBase

Gene information

Gene Pav_sc0002234.1_g010.1.mk
Chromosome name PAV_r1.0chr8
start 11211482
end 11225304
PAV_r1.0 name Pav_sc0002234.1
start 2079
end 15901
direction -
Annotation NR PREDICTED: LAG1 longevity assurance homolog 2
Sequence CDS ATGGAAGAAAGTCGCTCGAGTTCTGGTTCTAAGACGCACATGGAATCGTTCTGGAGCGAC AATGGCGCACCAGACGCTTGGCACTTCCTCGTCGTTATCTACTTCGCTTTTGGGTTTTTG GCTGCTCGGCTCTTCTTTGACAGATTCATCTTTTGCAAAATTTCCATCTGGTTGTTGAGC AAGGGATCTGCTCCATTGAAGCTCGATATGGCTACACGGGCAAAGATTGTAAAATGTTCA GAGTCACTTTGGAAGCTAACATACTATGCCACTGTTGAAGCATGCATTCTCAAGATAAGC TACCAGGAGCCATGGTTCAGAGATACAAAAGAGTACTTTAAAGGCTGGCCAAACCAGGAG TTGGGGCTTCCCCTAAAGCTTTTGTATATGGGTCAATGTGGATTCTATACCTACAGCATT GTTGCCCTCCTTACATGGGAGACTCGAAGGAAGGATTTCTCAGTGATGATGGGTCACCAT GTAATTACTGTTCTCCTGATTGGGTACTCATACATTACGAGCTTTTTTCGGATTGGCTCA ATCATTCTTGCCCTGCATGACGCGAGTGATGTATTTTTGGAAGCTGCCAAGGTTTTCAAG TATTCTGAGAAGGAGCTTGCCGCAAGTGTGTTCTTTGGATTTTTTGCTGTTTCGTGGCTC ATACTGAGGCTAATATTCTTCCCCTTCTGGGTTATAAGCTCATCAAGCTATGACCTTATT GACTGCTTGGATCTATCGAAGCTTGCTCCCAGAGCTCTGTACTATGTGTTCAATACAATG TTACTGATGCTGTTTGTGTTCCACATATACTGGTGGGTTATGATATGTGCAATGATAAGA AGACAGCTGAAAAATAGAGGAAAAGTTGGAGAAGATATAAGATCTGGATACTTGCCTGGA AGGCTCTATGATCTCAGTGCATCAAAATATGGAAGCCAAGATGAACTGAAGTCGTTGATA AGCGCCTTCCACGATAGTGGGATACAGACTGTGGCAGATATAGTTATAAACCACAGAACT GCAGAGAAACAAGATGAGAGAGGAATATGGTGCATCTTTGAAGGAGGAACTCCAGATGAT CGCCTTGATTGGGGCCCGTCTCTTATTTGCAGCGACGACACACAATATTCTAATGGCAAG GGGAATCCTGACACTGGAGCCGGCTACGATGCTGCTCCTGATATTGACCACAAAAACACA AGAGTGCAGAAAGAGCTCTCGGATTGGATGAATTGGCTAAAGACTGAAATTGGGTTCAGT GGGTGGAGACTTGATTTTGTCAAGGGATATTCTCCAGCAATTACCAAGTTGTATGTGACA AACACAAGTCCAAATTTCGCAGTAGGGGAACTTTGGAATTCCCTTGCTTATGGAAGTGAT GGAAAACCAGAGTACAATCAGGATGCCCATCGTCAAGAGCTTGCAGGATGGGTAGAGGGT GCTGGAGGAGATGTTACAGCATTTGATTTTACCACTAAAGGGATACTTCAACAGGCAGTC CAAGGGGAACTGTCGCGGCTGAAGGACCCGAATGGAAAGGCTCCAGGAATGATTGAGGAG ATCACTAAACTCATTGCAATCAGATCCCGGAACGGAATCAAACCCGACAGTACCTTGCGT ATTCTAGCATCTGATGCAGATCTCTACGTAGCTGCCATAGATGAGAAAATCATAGCAAAG ATTGGTTCAAGGTACGACGTTGGGAACCTTGTACCTCCAACCTACCAAATTGCAACTTCT GGAAAGGATTACGCCGTGTGGGAGAAAAAAGCCTGA
PEP MEESRSSSGSKTHMESFWSDNGAPDAWHFLVVIYFAFGFLAARLFFDRFIFCKISIWLLS KGSAPLKLDMATRAKIVKCSESLWKLTYYATVEACILKISYQEPWFRDTKEYFKGWPNQE LGLPLKLLYMGQCGFYTYSIVALLTWETRRKDFSVMMGHHVITVLLIGYSYITSFFRIGS IILALHDASDVFLEAAKVFKYSEKELAASVFFGFFAVSWLILRLIFFPFWVISSSSYDLI DCLDLSKLAPRALYYVFNTMLLMLFVFHIYWWVMICAMIRRQLKNRGKVGEDIRSGYLPG RLYDLSASKYGSQDELKSLISAFHDSGIQTVADIVINHRTAEKQDERGIWCIFEGGTPDD RLDWGPSLICSDDTQYSNGKGNPDTGAGYDAAPDIDHKNTRVQKELSDWMNWLKTEIGFS GWRLDFVKGYSPAITKLYVTNTSPNFAVGELWNSLAYGSDGKPEYNQDAHRQELAGWVEG AGGDVTAFDFTTKGILQQAVQGELSRLKDPNGKAPGMIEEITKLIAIRSRNGIKPDSTLR ILASDADLYVAAIDEKIIAKIGSRYDVGNLVPPTYQIATSGKDYAVWEKKA


| Top |