Cherry SNP DataBase

Gene information

Gene Pav_sc0002234.1_g130.1.mk
Chromosome name PAV_r1.0chr8
start 11292988
end 11296836
PAV_r1.0 name Pav_sc0002234.1
start 83585
end 87433
direction +
Annotation NR PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
Sequence CDS ATGGGGTCTAATTTCAACTTCAAGAACTTTGGTGATGCACCACCTGGGGAAGGCAATGGT GGGAAGGCAGCAGGAAATTTTACTTTGGCCCGGCAGTCTTCCGTATACTCTCTGACGTTC GATGAGTTCCAGAACACCATAGGTGGACTTGGAAAGGATTTTGGATCTATGAACATGGAT GAACTTTTGAAAAATATATGGACTGCTGAAGAGACTCAAGGCGTGACATCTACTTCTGGG GCTGGAGAAGGAAGTGCTCCTGGGGGTAATTTGCAGAGACAAGGGTCATTAACTTTGCCA CGAACACTTAGTCAGAAGACAGTTGATGAGGTTTGGAAAGACTTGATTAGAGAGACAAGT GATGCTAAATATAATACTGTTGCTACGGGTACAAATTTGCCACAGAGACAACAAACTTTG GGAGAGATGACTTTGGAGGAGTTTTTGGTGAGAGCAGGGGTTGTGAGAGAAGATGTCCAA CCAGTTGTAAGGCCTAATAATAGTGGATTCTATGGTGAATTATACCGTCCAAATAACCAC AATGGTTTAGCTCCCGGATTTCAACAACCAAGTCGAACCAACGGTCTTTTAGGTAATCGA GTTGCAGATAACAATAATTCGGTTCTTAACCAGTCTCCCAATTTAGCACTTAATGTTGGT GGAGTTAGATCTTCTCAGCAACAAACACAGCAGCTGCCCCCACAACAGCAGCCGCTCTTC CCCAAGCCTACAAATGTAGCTTTTGCCCCTTCTATGCATTTAATAAACAATGCTCAGTTA ACAAGCCCAAGAACCAGGGGACCAATGACTGGGGTTGTGGAACCTTCTATGAACACTGTT TTCACTCAAGGTGGTGGGTTTCCGGGAACAGGAATTGGAATGACTGGTTTAGGTACTGGG GGCGGTGCAGTTGCAGCAAGATCTCCCACAAATCAGATATCACCAGATGTGATTGCTAAG AGCAGTGGGGATACATCGTCGTTGTCACCAGTTCCTTACATGTTTAGCCGGGGAAGGAAG TCCAATGGAGCTTTGGAGAAAGTAGTTGAGAGAAGGCAAAGGAGAATGATAAAAAACAGA GAGTCTGCTGCAAGGTCCCGAGCTCGTAAACAGGCCTATACCTTGGAACTAGAGGCAGAA GTTGCAAAACTTAAAGAAATGAATGAAGAATTACAGAGAAAACAGACAGAAATTATGGAA ATGCAGAAAGATCAGATTTTGGAGACAGTGAAGCGGCAAAGGGGAGGTGGTGGAGGGAAT GCTGGAGATGTAAAAACTGAAATCTTAACCTGCTCTGTGATGATGGCCCAAAAAACAAAA AGGTAA
PEP MGSNFNFKNFGDAPPGEGNGGKAAGNFTLARQSSVYSLTFDEFQNTIGGLGKDFGSMNMD ELLKNIWTAEETQGVTSTSGAGEGSAPGGNLQRQGSLTLPRTLSQKTVDEVWKDLIRETS DAKYNTVATGTNLPQRQQTLGEMTLEEFLVRAGVVREDVQPVVRPNNSGFYGELYRPNNH NGLAPGFQQPSRTNGLLGNRVADNNNSVLNQSPNLALNVGGVRSSQQQTQQLPPQQQPLF PKPTNVAFAPSMHLINNAQLTSPRTRGPMTGVVEPSMNTVFTQGGGFPGTGIGMTGLGTG GGAVAARSPTNQISPDVIAKSSGDTSSLSPVPYMFSRGRKSNGALEKVVERRQRRMIKNR ESAARSRARKQAYTLELEAEVAKLKEMNEELQRKQTEIMEMQKDQILETVKRQRGGGGGN AGDVKTEILTCSVMMAQKTKR


| Top |