Cherry SNP DataBase

Gene information

Gene Pav_sc0002266.1_g100.1.mk
Chromosome name PAV_r1.0chr2
start 11463064
end 11469753
PAV_r1.0 name Pav_sc0002266.1
start 41311
end 48000
direction -
Annotation NR hypothetical protein PRUPE_ppa004029mg
Sequence CDS ATGTTGCCGCGCAGGTTATCCGTCATTTTTGGAGGCCTAGGTTACAACACGAACACTGTG ACCAACGAGCTCTTGCCCACTCTCAAGGTCCAAACGGATAAGGAAGTCTACAGGCCCGGC GATCCCATTATCATCACCATAGAGATTTCGAACCCTAGCAGCAATGACGGTACGGCTTAT TCGCTCTTGATCGAACGTCTGGGATTTGAGATTAAAGGGATTGAGAAGCTCGATTCCCAG TGGTTCGCCACGCAGAAACCCACGTCTGGATCTAAACAGAGAAGAGGTGAATATGTGTTC ATGGAATGCTCCACTCAAGCGCTGGTGACGAATCAGATTGTTTCCCCCGGGGCCAGGAAA TCATACGTGGTGCGGTCATTCCTGGCTAGCATTATACCACCATCATATAAAGGTGCTACC ATTCGCTATATGTACTATGTTAGAAGTACAATGTCTGGCCAATGGCTGATACTGGAAAAT GCTCATTCTCGTGGAGAATCAGTCAAAGATTTTCCTGAAATGGAGGCTCGTGTTCCAGTA CAAGTATGGGTCACTCAGAAAACCAGTGGCTTGGTGATGGAAGAAGGTCAAAGTGATGGG ATTGTTCCTTCTGCAACCATCCAAATGGATATGTATTGGAAAGAGATGGATGCAGACTCC GATTGGGTGAGAGCAAATGATACATATGATGGGGGGGTTGAGGAAGGCTATGAAAGCTCA AGGGATGAGATCTCATCTGTTTCTTCATACAATCCCATGAAAGAACATATAAACAGAACC TTTGGAAGTTCGCTATCCTTGCAATCAGCAAGGTCTTCGAATAAGGATAGCCCATATCTT GAAGGAGAGCGCACAAGTTTATCTTCAAATCTAGCACTCCCACAGCTCTCTGTGGCCGAA GTCTTATACGATACTGGCGCTGATCTTTCATTGCCCCTGAATTCATCTGCTATTGGCTCT CCAAGTCAGCAACCGAAACTTACAAAGCGGCTTTCTTTGGATGATGAAGCAAGGGCATCT TCTTCACCAGAATCTGGAGCTGTTGAAACATTAGCATCAGAAGGCTTTAGTCGAGGGAGG TCATACAATATCCGGCTGGATGACCAAGTTCTGCTTAGATTTTCCCCAAAAAATTCTGAT TCTAATTATTACTTCAGTGATATGATTGGTGGGACTCTTACTTTCTTTCATGAAGAAGGA GCTAGAAGGTGCCTCGAGGTAGTTGAGATATCACAAGTTTCTATAACGTTGGAGACTTCG GAAACTATTAGTCGGCGATTTGTCCATCCTTCTCGGAAGAATTCCCCCACAATTACGAAG ATTCAGAGTGATCATTATGAGGTCGTTTCAGATTTGGTGCAGACAAGTTTTCTTTTTTCC ATTCCTATGGATGGGCCTATGTCTTTTACCACTCCTCATGTATCTGTACGATGGGTCCTT CGATTTGAATTTTTTACCACTCCGAAGAATGTGGATTGGACCAGGTACGAGCATCCTCTT CTGATAGAGCGAAGAGAAAAAAGTGAGTGGGTTCTCCCAATCACAGTGCACGCACCTCCG GCTGTGGGACCCACTGGTCATCCCCGAAATGAGAAGGCTCTCTTTGGAACCCTTGGGGGT GTATAA
PEP MLPRRLSVIFGGLGYNTNTVTNELLPTLKVQTDKEVYRPGDPIIITIEISNPSSNDGTAY SLLIERLGFEIKGIEKLDSQWFATQKPTSGSKQRRGEYVFMECSTQALVTNQIVSPGARK SYVVRSFLASIIPPSYKGATIRYMYYVRSTMSGQWLILENAHSRGESVKDFPEMEARVPV QVWVTQKTSGLVMEEGQSDGIVPSATIQMDMYWKEMDADSDWVRANDTYDGGVEEGYESS RDEISSVSSYNPMKEHINRTFGSSLSLQSARSSNKDSPYLEGERTSLSSNLALPQLSVAE VLYDTGADLSLPLNSSAIGSPSQQPKLTKRLSLDDEARASSSPESGAVETLASEGFSRGR SYNIRLDDQVLLRFSPKNSDSNYYFSDMIGGTLTFFHEEGARRCLEVVEISQVSITLETS ETISRRFVHPSRKNSPTITKIQSDHYEVVSDLVQTSFLFSIPMDGPMSFTTPHVSVRWVL RFEFFTTPKNVDWTRYEHPLLIERREKSEWVLPITVHAPPAVGPTGHPRNEKALFGTLGG V


| Top |