Cherry SNP DataBase

Gene information

Gene Pav_sc0002286.1_g180.1.mk
Chromosome name PAV_r1.0chr1
start 28799893
end 28804686
PAV_r1.0 name Pav_sc0002286.1
start 56753
end 61546
direction +
Annotation NR PREDICTED: sugar transporter ERD6-like 6
Sequence CDS ATGAGTTTCAGGGAAGACAATGAAGAGGGGAGAGATCTCAGGAAGCCCTTCCTGCACACT GGGAGCTGGTACCGCATGGGTTCCAGGCAATCCAGTATGATGGGCTCGTCCCAGGTCATT CGAGATAGCTCCATTTCTGTGGTGGCTTGTGTTATGATTGTCGCTTTGGGTCCTATCCAA TTCGGCTTCACCTCTGGATATTCTTCTCCAACCCAATCAGCAATCACCAAGGATCTTGGA CTCACAGTGTCAGAGTCTTTAATGATTGCTGCCATTCCTAATGTTATCGGCTGGCTTGCT ATATCATTTGCCAAAGATTCTTCTTTTCTCTACATGGGAAGACTGTTGGAAGGATTTGGC GTGGGAATAATCTCGTACACGGTGCCTGTATATATAGCTGAGATAGCACCCCAAAACTTA AGAGGTGCTTTGGGTTCAGTCAATCAGCTCTCTGTAACCATTGGGATAATGCTGGCTTAT CTGCTTGGACTTTTTGTTCAATGGAGGATACTTGCAGTTCTGGGAATATTGCCTTGTACG ATATTGATACCCGGGCTCTTTTTCATTCCAGAATCTCCTCGATGGCTGGCAAAAATGGGT ATGACCGAGGATTTCGAAGCCTCTTTGCAAGTTCTCCGGGGATTCGATACTGATATTTCG GTTGAAGTGAATGAGATCAAGATTGGAATTGGTTTACTTGTTCTTCAACAGCTAAGTGGA ATTAACGGTGTTCTTTTCTATTCCAGTACCATTTTTGCAACTGCCGGGATTTCATCAAGT AATGTAGCCACATGTGGCCTTGGTGCTGTTCAGGTCATAGCCACCGGGGTGACTACTTGG TTGGTGGACAGAGCAGGCCGTCGACTTCTGCTTATTATCTCTTCTGCTGGAATGACAGTT AGCCTCCTAATCGTTGCAGTAGCATTCTTTCTAAAGGATTTGGTAGCAGCTGATTCAAAT ATTTTTAGCATATTGGGCATCATAACAGTGGTTGGAGTTGTGGCCATGGTAATTTCCTTC TCTCTGGGTGTAGGAGCTATTCCATGGATTATAATGTCCGAGATTCTTCCAATTAATATT AAAGGCCTTGCCGGAAGTGTAGCAACACTTTCCAACTGGTTCATAGCCTGGGTGGTCACG ATGACTGCAAACTTGCTGTTGGAATGGAGCAGTGGAGGAACCTTCACCATTTACACGCTT GTGAGTGCTTTCACCGTCGTATTTGTAACCATTTGGGTCCCCGAGACGAAAGGGAGAACT CTGGAAGAGATTCAGTTCTCCTTCAGATGA
PEP MSFREDNEEGRDLRKPFLHTGSWYRMGSRQSSMMGSSQVIRDSSISVVACVMIVALGPIQ FGFTSGYSSPTQSAITKDLGLTVSESLMIAAIPNVIGWLAISFAKDSSFLYMGRLLEGFG VGIISYTVPVYIAEIAPQNLRGALGSVNQLSVTIGIMLAYLLGLFVQWRILAVLGILPCT ILIPGLFFIPESPRWLAKMGMTEDFEASLQVLRGFDTDISVEVNEIKIGIGLLVLQQLSG INGVLFYSSTIFATAGISSSNVATCGLGAVQVIATGVTTWLVDRAGRRLLLIISSAGMTV SLLIVAVAFFLKDLVAADSNIFSILGIITVVGVVAMVISFSLGVGAIPWIIMSEILPINI KGLAGSVATLSNWFIAWVVTMTANLLLEWSSGGTFTIYTLVSAFTVVFVTIWVPETKGRT LEEIQFSFR


| Top |