Cherry SNP DataBase

Gene information

Gene Pav_sc0002326.1_g280.1.mk
Chromosome name PAV_r1.0chr3
start 9987040
end 9988428
PAV_r1.0 name Pav_sc0002326.1
start 143784
end 145172
direction -
Annotation NR unnamed protein product
Sequence CDS ATGACGACAAATGAATTTGAGTTCGTGAATATTAAGACACATTCTCTCAAAGTACACATT AACTGTGAAGGATGCGTGCAGAAAGTAAGAAAACTCCTCAGGAAGATCGAAGGTGTCTAT AGTGTACACATAGATGCAGAAGAGCAGAAGATCACAGTCACAGGAAATGTAGATTTTGCT ACTTTAATCAGAAAGCTGGGCAAAGCTGGTAAACATGCAGAGCCTTGGTCTCCAAGTTCC AACCAAACAAAAGCTCCTATGAATGGCCTCAATTTAGCCTCTGAAAATCAGCTTTTGCTC CCACCTTTCTTTGGCAGTGAAGGCCAACATGGCTGGGGATCTGGTAATTTTGTGGATGGA AATGGAAATTTGATTGGTGCTGCTCATCATGGAAAATTGCAGGGCGATGTTTTTCCCATG ATGGGCCGTACGGGTTTTCATGGCAATGCAGAAGAAGGGCTTGAATTTCGTGGCCTGCAA GATTTCTCTGCAGGATTTCCAGCAGTAGGTGAATATGGTAATTCAAGACCTGTGATGTTG ACCAACTCAGAAGGGTACCCTCACACTAATTTTGCACCTGCCTTCATGATCCCGCCTAAC ACTTCTGCGGCTCAGTATAACGCTGAATCAGCAACACCCGCTGGTATCTACTATTAG
PEP MTTNEFEFVNIKTHSLKVHINCEGCVQKVRKLLRKIEGVYSVHIDAEEQKITVTGNVDFA TLIRKLGKAGKHAEPWSPSSNQTKAPMNGLNLASENQLLLPPFFGSEGQHGWGSGNFVDG NGNLIGAAHHGKLQGDVFPMMGRTGFHGNAEEGLEFRGLQDFSAGFPAVGEYGNSRPVML TNSEGYPHTNFAPAFMIPPNTSAAQYNAESATPAGIYY


| Top |