Cherry SNP DataBase

Gene information

Gene Pav_sc0002359.1_g210.1.mk
Chromosome name PAV_r1.0chr1
start 14777553
end 14778926
PAV_r1.0 name Pav_sc0002359.1
start 124077
end 125450
direction -
Annotation NR Uncharacterized protein TCM_020116
Sequence CDS ATGAAATTCAATGGAACAGATAGATATTGTGATACTATGAAGAGGGTTTCCTCTTTGTCA CCAGTGAAGAAGATGAATGTCTCAAACCAAAGAGAAGATGAGTATCTCAGACCAAGATCA AATGGTGCTAAAAGTGCACCCATTAGAATACGATTGACAAAGGCAGGTCCTCGTCTATGC GAAAGCAGCAAGAAGGATGCGGCTGCAGCTGCTTTTTGCCAACCATCAGAAGAAGATCTT GATCTATACGAACAGTTTGGTAATGACAGAGAGTCGATGTGGTTGTCTACAGATTGTTCA TCACCTTCTGCCTTTTTTAGAGAGTATAGGTGGTCTGATTCATTTCACTCAAATGAGCTG TTGTTACCTTCTTGGTTGTCATTGCTGACAAGAGAAAATCCTATGGAAGAGGCATCTAAT TTGCCTATGCGGAAAGCTTCTCGAGATGAAGACAATAATTTAGAGGAAGATATGAAGGAT GAAAAGATAGTTACTTGGCTACTTAGTTCAGCTAAAAGTGATGCAAATGCAAGAGGTTTC TCTGTAACCTCTTCAACTCCTCTTAGCACAAAATCTGATTCTTCTCAGAGTCTAGATTTC GAGAGGATAGGTTTTCGCGTATCTTTATTGAATCTTGATGGAGAGGATAACAAATTGATA CCAGGTGCAGATCCAAAGTTGGATTATTTTCCGTCAGATTTTCCAAGTCCATCTTACAAG AGTAATTGGGGTCATGAATTTCAGTCATGTAATTTTAGTAGTGGAGCACAAAGTGAAACA TCAGGATGTGATTTTTCATCAGAACATGCTTCTGAAGCTGCAGATTGCTTAGATCTAAAT ACTGATGAACCACTTTTCTGGCCATACGAACAGAAAATCGATTGGAATTCTGAAGCAACT TGGAACTACTTTTCCATGTCGCCGCGGAAGGACGCAAGTATAACAACTTTTGGAAGTCCA CCAGATTCAGTTCAATTAAGCCACCATGATAGGAACATAGATCTCAAAGAAGGGCAGAGG AGAAGGCTAGTGTTCAGCTCAGGATCAGCAGCATCAAAGATAATGGAATTAAAACAAAGA TACAACAAGGGTGCACGCAGGACCAATACTTTGCCTTCAAGGTTGAGCAGGGCAACCAAA ACTTCTGCGAAAATTGTACCTTTAAACATGAAAGATGATACTGCAGAACTCAAAGATAGA AAAGCTCATGTTGAAAGACCAGTCGGTATGGTTAAAGCTCCTGTAGAAGAAGGTTCTGCT TCAAAAGAACTTCCAATTGAGATGTTCTTGGGCCTTGATGAGTTTGACGGGCATGAGGGA GTTGATTCAGAATTTGATAAAGATGACTTCTCACTGCATCTGTCTCTCCGTTAA
PEP MKFNGTDRYCDTMKRVSSLSPVKKMNVSNQREDEYLRPRSNGAKSAPIRIRLTKAGPRLC ESSKKDAAAAAFCQPSEEDLDLYEQFGNDRESMWLSTDCSSPSAFFREYRWSDSFHSNEL LLPSWLSLLTRENPMEEASNLPMRKASRDEDNNLEEDMKDEKIVTWLLSSAKSDANARGF SVTSSTPLSTKSDSSQSLDFERIGFRVSLLNLDGEDNKLIPGADPKLDYFPSDFPSPSYK SNWGHEFQSCNFSSGAQSETSGCDFSSEHASEAADCLDLNTDEPLFWPYEQKIDWNSEAT WNYFSMSPRKDASITTFGSPPDSVQLSHHDRNIDLKEGQRRRLVFSSGSAASKIMELKQR YNKGARRTNTLPSRLSRATKTSAKIVPLNMKDDTAELKDRKAHVERPVGMVKAPVEEGSA SKELPIEMFLGLDEFDGHEGVDSEFDKDDFSLHLSLR


| Top |