Cherry SNP DataBase

Gene information

Gene Pav_sc0002360.1_g300.1.mk
Chromosome name PAV_r1.0chr3
start 17373416
end 17376787
PAV_r1.0 name Pav_sc0002360.1
start 167100
end 170471
direction +
Annotation NR PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.5
Sequence CDS ATGGAACCAGCTGAGTGTACGAATAACCAGAGCAATGGCAACCATGGAGAAGACATCATT GGGTGGTTTGAAGATGTGACTGAGAAAGCTGGTTTGGTTCAAACACAGACACTCAGGAAG ATACTTGAGCAAAACTGCAGTGTGGAATATCTCAAGCAATGGTTGGGGGACATCAAAATC CAAGAGGTAGATGGATTTGTATTGGAATCTCTCTACACTTCTTTGGTGCCCCTTGCTTCA CATGCAGATTTAGAGCCTTATATTCACAGAATTGCAAATGGGGACACTGGCCCTATACTC ACCCAACAACCTATGACCACTCTCTCCTTAAGTTCTGGAACCACAGATGGGAGACAGAAG TACGTACCCTTTACACACCATAGCGCACAGACCACTCTTCAAATATTTAGGTTGGCTGCA GCTTACAGATCAAGAGTTTATCCAACAAGGGAAGGAGGGAGGATCCTGGAATTCATATAC AGCAGCAGACAGTTCAAAACTAAGGGAGGATTAACAGCAGGAACAGCCACAACTCACTAC TATGCCAGCCAAGAATTCAAGATCAAACAGGAAAAAACCAAGTCATTCACTTGCAGCCCA GAAGAGGTCATTTCAAGTGGAGACTGCAAACAATCAACATACTGCCATCTCCTTCTTGGC CTCTTCTTCTCTGATCAAGTAGAGTTCATAACCTCCACCTTTGCCTATAGCATAGTGCAG GCCTTCATCACTTTTGAAGAACTCTGGAAAGAGTTGTGCAATGACATCAGAGATGGCACT CTAAGCAAAAGAATCAATCTACCGAACGTGCGAAAAGCGGTCTTGGATATCATCTCCCCA AACCCAACATTGGCTTCAAAAATCGAAGCTAGTTGCAAGGGCTTGGAAGATTTGGATTGG TTTGGTCTAATTCCTAAGCTCTGGCCAAATGCCAAGTATGTGTATTCTATAATGACAGGA TCAATGCAACCATACTTGAAAAAACTCAGACGCTTTGCAGGGGATGTGCCATTAGTTAGT GCAGAATATGGATCAACTGAGAGTTGGATTGGGGTGAATGTGGATCCTTGTTTGCCTCCA GAGGATGTGACTTTTGCTGTGGTACCAACTTTTTCTTACTTTGAGTTCATACCACTCCAT AGACATAAGCAAGATTGCAATTTAGCCATTGATGACTTCATAGAAGATAAACCAGTCCCA CTATCCCAAGTCAAGGTTGGACAGCAATATGAGATAGTCCTCACTACTTTCACTGGACTT TATAGGTACAGGTTAGGGGATGTAGTGGAAGTGGCTGGTTTCCACAATGGGACTCCAAAA TTGAACTTTATATGCAGAAGAAAGCTTATATTGACAGTAAACATTGACAAAAACACAGAA AAGGACCTTCAGATAGTGGTAGAGAGAGGGTCTCAATTGCTGAGCAAGTCCAAAGCTGAA CTGGTTGATTTTACAAGCCATGCTGATCTGCTAACTCAACCAGGCCACTACATCATATAT TGGGAGATCAAAGGTGAAGTTGAAGAGAGGGTTCTTGGTGAATGTTGTAGAGAGATGGAT GCATCATTTGTGGATCATGGCTATGTGGTCTCAAGGAGAAGCAATTCAATTGGGCCTCTA GAGCTACGCATTGTGGAGAAAGGAACTTTCAAGAAAATTTTGGAACATTTCATAAGAAAT GGTTCTGCTTTGAGCCAATTTAAGACCCCTAGGTGCACCAGCAACAAGGTGATCCTGAGT ATTCTCAATCTATGCACTATTAAAAGGGTTTACAGCACTGCATTTGCTCATTAG
PEP MEPAECTNNQSNGNHGEDIIGWFEDVTEKAGLVQTQTLRKILEQNCSVEYLKQWLGDIKI QEVDGFVLESLYTSLVPLASHADLEPYIHRIANGDTGPILTQQPMTTLSLSSGTTDGRQK YVPFTHHSAQTTLQIFRLAAAYRSRVYPTREGGRILEFIYSSRQFKTKGGLTAGTATTHY YASQEFKIKQEKTKSFTCSPEEVISSGDCKQSTYCHLLLGLFFSDQVEFITSTFAYSIVQ AFITFEELWKELCNDIRDGTLSKRINLPNVRKAVLDIISPNPTLASKIEASCKGLEDLDW FGLIPKLWPNAKYVYSIMTGSMQPYLKKLRRFAGDVPLVSAEYGSTESWIGVNVDPCLPP EDVTFAVVPTFSYFEFIPLHRHKQDCNLAIDDFIEDKPVPLSQVKVGQQYEIVLTTFTGL YRYRLGDVVEVAGFHNGTPKLNFICRRKLILTVNIDKNTEKDLQIVVERGSQLLSKSKAE LVDFTSHADLLTQPGHYIIYWEIKGEVEERVLGECCREMDASFVDHGYVVSRRSNSIGPL ELRIVEKGTFKKILEHFIRNGSALSQFKTPRCTSNKVILSILNLCTIKRVYSTAFAH


| Top |