Cherry SNP DataBase

Gene information

Gene Pav_sc0002360.1_g350.1.br
Chromosome name PAV_r1.0chr3
start 17353953
end 17354273
PAV_r1.0 name Pav_sc0002360.1
start 189614
end 189934
direction -
Annotation NR
Sequence CDS ATGACCACAGAGTATCGAACACCAAAATCGGACTGTTGGAATGTTCACATCCAGAACTTT GTGCAGCCGGTCGTGGTAAAGAAGCTTGTGACGCAGATATTGGTGGTGTTAGTTTGGGGC CATCATCTGCAGCCTGTTTACAAAGGATGTATCTTCTTGGTTCTAGCAGTAGTCACAACT AGCGCGCACCCCATCATTGATAATCTGGTCATTAGGTCTTTATTTCACAAAGAAGTCAAC CTTCACTTGATCCACTGCCGTGAGGCTCTCGCCGTATCATGTCTAATAGGTCTTGCACGA CTTCAGACATCAGTGGCCTGA
PEP MTTEYRTPKSDCWNVHIQNFVQPVVVKKLVTQILVVLVWGHHLQPVYKGCIFLVLAVVTT SAHPIIDNLVIRSLFHKEVNLHLIHCREALAVSCLIGLARLQTSVA


| Top |