Cherry SNP DataBase

Gene information

Gene Pav_sc0002387.1_g040.1.mk
Chromosome name PAV_r1.0chr2
start 390384
end 395835
PAV_r1.0 name Pav_sc0002387.1
start 14054
end 19505
direction +
Annotation NR PREDICTED: putative disease resistance protein At4g19050
Sequence CDS ATGGAAACTATAGTACTGGCAGCTGCTTCCGCAAAGGACAATATCCATGAAGAAGGGAAA GAGACAGGTGGCAGTGGCACGATGACTTTGTTTCCCAAACTACCGATCAATGGCTTCAGA CTGTACGACTTACCAAACCTCGAGAGATTTTGCCTTGATGCCTATTCTTTTGCATGGTCC TCCTCCACGAGATATATGTACGTGGATGAATGTCCCAAATTAAAGACATTGGGTTTTGCA CTAGTAAGCAAAAAGCTGCTTGTAGCAGTTGCGGAGAATTTGAGTGATGATCATGTAAGA GGTAGAGAAGAATCAAGATCTAGATGTGCATCATCAACTGGATCTGGATCTTTATTTGGA TGTGCGCCACTAGTCTGCTTACAAAGTCGTCCATCTACTCGCAACTTTACTCAAATATTG CCCCGCCCTGTAAATAGAGAGGTTACGCTGGCAAATCTTCAGAACTCAAGTGCTAACTAC AATCTAGAAGATCTCCATGTAGTAAGGTGCGATTTATTGGAAGTGATATTTTTGGTTCAA GAAACCCCTTCTACTCAAGCATTTGATAAGCTGAGGAAATTAGTATTGTGGTTGTTACCA ATGCTGAGCCACATATGGGAAAAGGGTTTACAAGTTAGCTCAGGCTTTGGAAACCTGAGA TTCCTAGGTGTATGGCAATGTCACAATTTGAGATACTTGTTTTCACCGCACATAGCCAAA CTTCTTACCTGTCTTGAGACAATAGAAGTTTCCAATTGTAGTGCGATGGAGAAAATTGTT GGAGAGGCAAAAGGAGGAGGAGAAAGTATTAAGGATGAATTGACATTTCCGCACATGAAT TATATCCAACTTGTGGATTTACCCAAACTTGAATCTTTCTACTCTCAAGCTCATACTTTG AAGTGGTCGTCAGCCTTGGAGAAAATCACAGTTCGAAATTGTCCAGAATTAAAAGCGTTT GCTTCTAAGTCTTTGTATGTGTAA
PEP METIVLAAASAKDNIHEEGKETGGSGTMTLFPKLPINGFRLYDLPNLERFCLDAYSFAWS SSTRYMYVDECPKLKTLGFALVSKKLLVAVAENLSDDHVRGREESRSRCASSTGSGSLFG CAPLVCLQSRPSTRNFTQILPRPVNREVTLANLQNSSANYNLEDLHVVRCDLLEVIFLVQ ETPSTQAFDKLRKLVLWLLPMLSHIWEKGLQVSSGFGNLRFLGVWQCHNLRYLFSPHIAK LLTCLETIEVSNCSAMEKIVGEAKGGGESIKDELTFPHMNYIQLVDLPKLESFYSQAHTL KWSSALEKITVRNCPELKAFASKSLYV


| Top |