Cherry SNP DataBase

Gene information

Gene Pav_sc0002445.1_g080.1.mk
Chromosome name PAV_r1.0chr1
start 31305533
end 31307588
PAV_r1.0 name Pav_sc0002445.1
start 39817
end 41872
direction -
Annotation NR PREDICTED: pollen-specific protein SF3-like
Sequence CDS ATGCCACCACTGCAAGGGAACCCTCAAGGGACACCAAAAATTGTAAAACCAGAGAGACCT GTTGATAATGAGAAACCTGCAGTAGCCAAAGCTTCAAGTATGTTTGGTGGAACCAGAGAT AAATGCTTTGGCTGCAAGAATACTGTTTATCCAACAGAAAAGGTTACTGTGAATGGAACT CCTTACCACAAGATGTGTTTCAAATGCTCACATGGAGGATGTACAATCAGCCCATCAAAC TATATTGCGCACGAGGGCCGACTCTACTGCAAACACCACCACACCCAACTCATCAAGGAG AAAGGAAACTTAAGCCAGCTTGAGGGTGACTATGAGAAGAACACCGTCGATGAGAATGCC AGTGCCAGAGAAGTTGCTACCGAAATATGA
PEP MPPLQGNPQGTPKIVKPERPVDNEKPAVAKASSMFGGTRDKCFGCKNTVYPTEKVTVNGT PYHKMCFKCSHGGCTISPSNYIAHEGRLYCKHHHTQLIKEKGNLSQLEGDYEKNTVDENA SAREVATEI


| Top |