Cherry SNP DataBase

Gene information

Gene Pav_sc0002445.1_g160.1.mk
Chromosome name PAV_r1.0chr1
start 31337390
end 31339126
PAV_r1.0 name Pav_sc0002445.1
start 71674
end 73410
direction +
Annotation NR hypothetical protein PHAVU_001G027800g
Sequence CDS ATGGGGCTGCTGTGTTGTTTCGATGGAGGCAACAATGCACAGAGAAAAGAAGAAGACAGA ATAGCCTCCGCGGAAGCTCTTGCCAAAGCTGCCGAAGCGGCCCAGAGAAGGCAAGAAGAA TTCGAAAAGTCTGCAGCAGGAAGAGCTGCACGTGCACAGCAACAGGCGGTTGCAAAGCAA GCTGCCAGCGCTAACAAAGGCGAACCAGTATTAAAGTGGTCGATGGGTTGA
PEP MGLLCCFDGGNNAQRKEEDRIASAEALAKAAEAAQRRQEEFEKSAAGRAARAQQQAVAKQ AASANKGEPVLKWSMG


| Top |