Cherry SNP DataBase

Gene information

Gene Pav_sc0002476.1_g010.1.mk
Chromosome name PAV_r1.0chr6
start 13076458
end 13082518
PAV_r1.0 name Pav_sc0002476.1
start 280
end 6340
direction +
Annotation NR PREDICTED: 2-isopropylmalate synthase 1, chloroplastic-like isoform X2
Sequence CDS ATGACCTTAGATTGTCGTGGGGATCATGTGCTTGGGGGGCTTTATACCGGGATCAATGCT CGGCATATCTATATAACAAGCAAGATGGTCGAAGAGTATACTGGGTTGCATGTGCAGCCA CACAAGGCTATTGTTGGAGCTAATGCTTTTGCACATGAAAGTGGTATCCATCAGGATGGA ATGCTCAAGCACAAAGGTACATATGAAATTATATCTCCTGAAGATATTGGGTATGAACGG TCCAATGAAGCTGGTATTGTCCTCGGGAAACTTAGTGGACGCCATGCTTTGAAAAAGCGA CTTGAAGAGAGAGTAACCGATGCCGATCTCAGAGCATTAGTGTCGGATGAAGTTTTTCAG CCAGAAGTTGTCTGGAAGCTTCATGATTTACAGGTTACCTGTGGAACTCTTGGTCTTTCC ACAGCAACTGTTAAATTATTCGATGCTGATGGGAGAGAACATGTGGCATGTGCAGTTGGA ACGGGTCCAGTGGATTCAGCTTACAAGGCTGTTGATCTCATTGTAAAGGAACCGGTAACA CTCCTTGAGTACTCTATGAATGCTGTCACAGAAGGAATCGATGCAATAGCAACTACTCGT GTTTTGATCCGAGGGGAAAACAGTCATATAACTACTCATGCTCTCACCGGAGAAACAGTT CAACGGACGTTCAGTGGAATTGGGGCAGGAGTGGATATTGTTGTGTCTAGCGTGAAGGCC TACGTTGGCGCATTGAATAAGATGTTAGGTTTTAAGGAAAGTTCCCCGACAAAGGTTCCC GTAGAACGAACCCCAGTGTCTGCATGA
PEP MTLDCRGDHVLGGLYTGINARHIYITSKMVEEYTGLHVQPHKAIVGANAFAHESGIHQDG MLKHKGTYEIISPEDIGYERSNEAGIVLGKLSGRHALKKRLEERVTDADLRALVSDEVFQ PEVVWKLHDLQVTCGTLGLSTATVKLFDADGREHVACAVGTGPVDSAYKAVDLIVKEPVT LLEYSMNAVTEGIDAIATTRVLIRGENSHITTHALTGETVQRTFSGIGAGVDIVVSSVKA YVGALNKMLGFKESSPTKVPVERTPVSA


| Top |