Cherry SNP DataBase

Gene information

Gene Pav_sc0002493.1_g060.1.mk
Chromosome name PAV_r1.0chr1
start 1593628
end 1601721
PAV_r1.0 name Pav_sc0002493.1
start 22240
end 30333
direction +
Annotation NR PREDICTED: uncharacterized abhydrolase domain-containing protein DDB_G0269086-like
Sequence CDS ATGGAAAACGAGAACATTCCTGATCAGAGAGAAGAAAGTGGAGTCCCGAATCAAGATTCT CAAAGTCTTGATCTTGAAGCTCTTCAAGCGACATCAGAACTGAACAAATCCACCATGGAC AATAAGGGCAGCGCATCGATCTCGACTGAAGAAATTGTGGGTCGTGACCAGCGTACTGAG TTGGAGGTTGAGGAAGAAGAAAGTCTAAATATGAGTGGGGTTTTGCTGGGTAGGACTGAA GGGTTGAAAAGTGAAGAAGAAGATGCTGTGAAAGCAAAGTTCTTGAATGGAAAAGAGAAC AGTACTGAAGATGGGTCAGTGTGTGGACAAGAGAACAGTACTGAAGATGGGGCAGTTGCT GATCAGCAAGGCCTCAATCCTCCACTTCATTCTGAAATTGCTGAACAGAAACACGCTGCA GATTCAGAATTGAGGCATTCTTGTAGTTCTGAAGGAGATGGGAAGGAGATTGTGGGTTCA GATGAGATTGTGAAAGGAGAGGTTGTGGAATCAGTGTTCTTGAATGAAAAAGTGGTGGGT TCGGATGAGAATCTGGGTTTGATAACTGGGTCAGTGTCAGTGGGTGGACAAGAAAAGACT GAAAATGGGAAAGGGTTAGTTACTGATCAACAAGACCTCAATAATCTTGTTCCTGAAATT GCTGAGAAAGAGCAGATTGGTTCTGGTTCAGGAGGAGTCACAGATCAAAATTTTGAGTTT GGAATGAGTGCAGATGACGTGACATTAGGAGAGGCTGATGAATCCAATCAAGAATGGAGG GATGTCAAAGAGGCTATCATGAGAGCAGATCAGCTGGACCTAGAGTCTATTGGCCTAAAG ATTGAACGTCGGGTGCGAGCTTCGGTTGAGGACGTGGTGAGATATCCCCAGATGAATTCA AAGACAATGAGTCTCTCTATAGGTGACTGGGAGAGAATTCTGGAGATGAGAGATGTTTCT GGATTGATGGCAGGGTATGAGACTCGGGTTTGTCCATTGGAAGCTGATCAAGTACCTATG CAGAGAGAACTTGGAGAGCTGAAAAAGAAAAACGTTGAGATTACATTCGAGAATTTGTCT CTCGAGGCACAGACAGATGGAGAGCAAAGAAAGATGCAGGCATTAAAGGCGCATTCTGAG TCTCAACTTTCTGATATGGAAGGTAAACTTGGTGTTATTAAGGAAGCAGAACTTGATAAG GGGAAGACTATTGCTGAACTTGAAGAAGAAACAAAAACTGAAGTTGAGAAGGAAAAGAAT GAGATTCATGAATTGCAGGAACTAGTTATCGTGGAAGAATCAAAAGAGACTGAGTTGAAA GTGGAGATGCCATCGAAGGCCCCAGGGCTGCTGCATGGGCCTAAGCTGCTGATGTCTGCC GGTGTCGTAATAACTGCTATACTTTACACAGCATTGAAGATGAAGCGAGGGCAACTTGGA ATTGGGATAGTATCATATAGCCCCCTCGGCCGAGGGTTTTTTGGTGGTAAGGCAGTGGTA GAGAGCTTGCCTGCAGAGAGTTTGCTGTATACACACCCCAGGTTCAATGGGGAGAATTTG GAAACGAACAAACTTCTCTATGGCAAACTTGCCAACCTTGCTGCAAAGCATGCATGCACG GTTCCTCAATTAGCTCTGGCATGGCTTCTCCATCAGGACAATTATATAGTCCCAATCCCT GGGACCACTCAAGTTAAGAACCTTGATATCAATATTGGATCATTGGATGTAATGCTTACA GAAGAGGATTTGAAAGAAATTTGTGATGCTGTTCCCATTGATGAAGTTTCTAGATTGGGT TTTGGATGTGGAGGATTATCAGGAATATACAACGCTCCTCTCTCCCATGAAGCTGGATGT TCAGTTATTAAGGAAGCATTTAGTAGGGGCATCACCTTCTTTGATACTTCAGATATTTAT GGTGATAATCATGATAATGAAATCATGGTTGGAAAGTTCTCTGTTTCACTTTGTTCAGGG GTTGAGTGGCAATATAAAGAGGAAAAAGAAAAGCAATACCACATTATTTACCTTGTGTTT TCTTTGCAGATATGCAGCATGAGGCTTGGAATTGGGATAGTATCTTATAGCCCACTTGGA CGTGGGTTCTTTGGTGGGAAGGCAGTTTTGGAGAGCTTGCCTGCAGATAGTTTGTTGTCT ATGCATCCAAGATTCAATGGGGAGAATTTGGAAAAGAACAAACTTCTCTACAACAAACTT GCCAACCTTGCTGCAAAGCATGCGTGCACTGCTCCACAATTAGCTCTGGCATGGCTTCTC CATCAGGGCAGTCACATAATCCCAATCCCTGGGACCACTAAGGTTAAAAACCTTGATATC AATATTGGGTCATTGGATGTGAAGCTTACAGAAGAGGATTTGAAAGAAATTTGTGATGCT GTGCCCATTGATGAAGTTGGTGGGGAGCGAGAGTATGAAGTTTTCTCAAAATATGTCTGG AATTTTGCAAATACCCCATCCAAGTGA
PEP MENENIPDQREESGVPNQDSQSLDLEALQATSELNKSTMDNKGSASISTEEIVGRDQRTE LEVEEEESLNMSGVLLGRTEGLKSEEEDAVKAKFLNGKENSTEDGSVCGQENSTEDGAVA DQQGLNPPLHSEIAEQKHAADSELRHSCSSEGDGKEIVGSDEIVKGEVVESVFLNEKVVG SDENLGLITGSVSVGGQEKTENGKGLVTDQQDLNNLVPEIAEKEQIGSGSGGVTDQNFEF GMSADDVTLGEADESNQEWRDVKEAIMRADQLDLESIGLKIERRVRASVEDVVRYPQMNS KTMSLSIGDWERILEMRDVSGLMAGYETRVCPLEADQVPMQRELGELKKKNVEITFENLS LEAQTDGEQRKMQALKAHSESQLSDMEGKLGVIKEAELDKGKTIAELEEETKTEVEKEKN EIHELQELVIVEESKETELKVEMPSKAPGLLHGPKLLMSAGVVITAILYTALKMKRGQLG IGIVSYSPLGRGFFGGKAVVESLPAESLLYTHPRFNGENLETNKLLYGKLANLAAKHACT VPQLALAWLLHQDNYIVPIPGTTQVKNLDINIGSLDVMLTEEDLKEICDAVPIDEVSRLG FGCGGLSGIYNAPLSHEAGCSVIKEAFSRGITFFDTSDIYGDNHDNEIMVGKFSVSLCSG VEWQYKEEKEKQYHIIYLVFSLQICSMRLGIGIVSYSPLGRGFFGGKAVLESLPADSLLS MHPRFNGENLEKNKLLYNKLANLAAKHACTAPQLALAWLLHQGSHIIPIPGTTKVKNLDI NIGSLDVKLTEEDLKEICDAVPIDEVGGEREYEVFSKYVWNFANTPSK


| Top |