Cherry SNP DataBase

Gene information

Gene Pav_sc0002574.1_g160.1.mk
Chromosome name PAV_r1.0chr2
start 20776983
end 20780180
PAV_r1.0 name Pav_sc0002574.1
start 72016
end 75213
direction -
Annotation NR PREDICTED: eukaryotic translation initiation factor 3 subunit F
Sequence CDS ATGGCGGTGATCGAGCACACAGTGTTGCAGTTCTCCACGTCGTCGTCATCGAGCTTGTCG GCGAAGGTTCATCCTCTCGTCATCTTCAACATCTGCGATTGCTATGTAAGGCGTCCTGAC CAAGCCGAGCGCGTTATTGGCACGCTCCTCGGCTCTGTCCTGCCTGATGGCACGGTCGAT ATTAGAAACTCCTACGCCGTTCCTCATAACGAGAGCGCGGACCAGGTTGCTTTAGATATC GATTACCATCACAATATGCTCATATCCCAGCAAAAGGTGAATCCGAAGGAAGTCATTGTT GGATGGTATTCTACTGGTTTTGGAGTTACTGGGGGTAGCGCATTGATCCATGAATTCTAT TCTAGGGAGGCTCCCAACCCAGTTCATTTGACTGTTGATACTGGATTTAGAAATGGGGAG GGTACCATTAAAGCCTATGTTTCAGTGAATTTGTCTCTTGGAGATCGGCAACTTGCAGCA CAGTTTCAAGAAATTCCTCTTGATCTTCGCATGGTTGAAGCTGAGAGAGTTGGATATGAT ATTCTAAAGACCACAATGGTTGACAAACTCCCTACTGATTTGGAAGGAATGGAAGCCTCA ATGGAGCGACTCCTAGCTTTAATTGATGATGTTTACAAATATGTTGACAATGTTGTGGTT AGTAAGGAGGAAGGTCATGTTGAACCCGATAACAACATAGGGAGATTTCTCTTAGATGCG GTTGCATCTCTTCCGAAATTATCTCCTACAGCTTTTGATAAGCTTGTGAATGACAGCCTG CAGGACAATTTGCTCTTGCTCTATTTGTCAAGCATCACCAGGACACAGCTCACCCTAGCC GAAAAGTTGAACACGGCTGCGCAGGTTCTGTAA
PEP MAVIEHTVLQFSTSSSSSLSAKVHPLVIFNICDCYVRRPDQAERVIGTLLGSVLPDGTVD IRNSYAVPHNESADQVALDIDYHHNMLISQQKVNPKEVIVGWYSTGFGVTGGSALIHEFY SREAPNPVHLTVDTGFRNGEGTIKAYVSVNLSLGDRQLAAQFQEIPLDLRMVEAERVGYD ILKTTMVDKLPTDLEGMEASMERLLALIDDVYKYVDNVVVSKEEGHVEPDNNIGRFLLDA VASLPKLSPTAFDKLVNDSLQDNLLLLYLSSITRTQLTLAEKLNTAAQVL


| Top |