Cherry SNP DataBase

Gene information

Gene Pav_sc0002632.1_g010.1.mk
Chromosome name PAV_r1.0chr0
start 53804836
end 53805312
PAV_r1.0 name Pav_sc0002632.1
start 3765
end 4241
direction -
Annotation NR PREDICTED: cysteine-rich receptor-like protein kinase 2
Sequence CDS ATGAAGCAAGAATATCTGGGTATGGTATTGCCAATAACAATTACATCAATATGGTGCAGG TGGAGTTGTCTGATCAGAAGCGTTGATGCAAGCCCACAGATCAATCTACTAAACGAGGGC TGCAGCCAATACAATGCCACAAACTTGCCTGACTTCTATACCAATCTCAACGCCACTTTG TCAGACCTCAAAACACAGCTCAACAACAGCACCCACTTTGCCACGGCACAGCAGGCCAGG GGTTCGGCTCCTGTCTATGCGATGGTGCAGTGCAGGAACTACCTCTCCACAGCTGACTGC GCTGCTTGCTTTGCCGCCGCAGCATCCCAAATTCGCAACTGCTCCGCTGCCAATGGTGCC CGTGTCATCTACGACGGTTGCTTCCTCAGGTACACCCTGGTCCCTGCTGTTGCTCCACTA CTCTTCCATGATTTGGTTTTGTATATTTATTTGTTTTCTAAACTAAATGACAACTAG
PEP MKQEYLGMVLPITITSIWCRWSCLIRSVDASPQINLLNEGCSQYNATNLPDFYTNLNATL SDLKTQLNNSTHFATAQQARGSAPVYAMVQCRNYLSTADCAACFAAAASQIRNCSAANGA RVIYDGCFLRYTLVPAVAPLLFHDLVLYIYLFSKLNDN


| Top |