Cherry SNP DataBase

Gene information

Gene Pav_sc0002645.1_g160.1.mk
Chromosome name PAV_r1.0chr6
start 12670067
end 12675457
PAV_r1.0 name Pav_sc0002645.1
start 66484
end 71874
direction +
Annotation NR PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1
Sequence CDS ATGCAGGCTGATGGCAACCTCGTTTCTTACCAGATAAATATCTCCACTCCAGAAGCTGCT TATTGGGCTTCCAACACTTACGGTGACATGATGCTCAGTCTGAAAGTATGGGGGTTTCTC GTTTTGCTTCCTGAAACTGGTACAGGTTCTGGACATCCCTTGGCAACTGGCTCATATGAC CCCCGCAATAACAGAACTATTATCTACCGCGCAACGCTGGATGCTGATGGGATTTTCAGA TTGTACTTGCACAATTACTCTGTGATGAGCCGCAGGTCAAGAGTGTTGATTGTTTGGTCC AATTTGCATGACCAATGTGAAGTCAGAGGTGTCTGTGGCTTCAACAGTTACTGTGCACTC ATATTTGGAAAGACAAACAAAACTGAGTGTCATTGTTATCCCGGTTTTTTAATCAACCCC AATGATGCGTTTCGGGGCTGCTATATGAACGGTAGTGACGATGGCTGCACTGGCAATGAA GGCCCAAGGCTGCGGTACAACATGGCTTCCATAGACCATGTGTTATGGCCAGGTGACCAT CCTTATTCAGTGGTGCGATTAGAGAAGCTACGAGTTTGCAGCGACTCTTGCCTGGAAGAC TGTAGTTGTAAGGCAGTGCTGTATATTAATGGCAGTTGCAACAAATACAAGATACCACTT AGATATGGTAGAACAAGCCCAGATATATCAGCCACAGGCTTCATCAAGGTAGCTGCAACA CACAATCTGCAGTTTCATAATCCAATGGCTAACAGAAATTCGACATTGGTGAAATATGAA ACCAAGAATAGTCGTGGCTTGATTGTAATTCTTGCTGCCGGAGAAGTATATAAGCTTGTG GAAGATGATGATCAAAATGTAGATTTGAAGACACTAGAGAGAATGATTAAAGTGGGGCTG TGGTGTGTTCAGGACGACCCAGGTTTGCGTCCCCTCATGAAGAACGTAATCTTGATGTTG GAAGGGACAACGGATATACCAGTCCCTCCATCTCTAGAGCTTCCCAAGCCTCTTCAACTT TATCTTAACGCTACAGGTCGTCTAGTTCTCATCAACAGCACTAATTGGGAAGAACACAAT GTTTTAGGTGATGATGAATCGTCCAAAACCAACTACAAAAACGGTACCATATATCGTGCG ACTGTTGACGTGGATGGAAATTTCCGGTTGTGTTCTCATGAATATGATGAGAGTACTGGA AAATTCCAGCCATCCCTTATTCTGTGGCAAGTACCGGAGGATCCTTGCGATGTTAAAGGC TTCTGTGGCCTTAACAGCTACTGCACATGGGACGACAATAAACCAAACTGCCGTTGCCTT CCTGGATCTGATTACGCTGACTCCAATCACATGACACTCGATTGCTTGAGAAACTATACT CAAGTAGAGTGTAAAGATGGGAAAGAAAATACGTCAAGTTATCACATGACCACCATGGAG AATATGGTGTTGGAAGACTCTGCTTATGATCAAGCACAAATGTCGACTCTCGTGGGTGGT GAAGAGGTCGATAAAAAGACGCTGGAGAACATGGTTAAGGTGGGATTATGGTGTATACAA GATGAACCAGCTCTGCGTCCTTCAATGAAGTCTGTTGTGTTGATGTTACAAGGTATTACT GATATAGCTATTCCTCCATGTCCAACTGCTACCTCCATGTAA
PEP MQADGNLVSYQINISTPEAAYWASNTYGDMMLSLKVWGFLVLLPETGTGSGHPLATGSYD PRNNRTIIYRATLDADGIFRLYLHNYSVMSRRSRVLIVWSNLHDQCEVRGVCGFNSYCAL IFGKTNKTECHCYPGFLINPNDAFRGCYMNGSDDGCTGNEGPRLRYNMASIDHVLWPGDH PYSVVRLEKLRVCSDSCLEDCSCKAVLYINGSCNKYKIPLRYGRTSPDISATGFIKVAAT HNLQFHNPMANRNSTLVKYETKNSRGLIVILAAGEVYKLVEDDDQNVDLKTLERMIKVGL WCVQDDPGLRPLMKNVILMLEGTTDIPVPPSLELPKPLQLYLNATGRLVLINSTNWEEHN VLGDDESSKTNYKNGTIYRATVDVDGNFRLCSHEYDESTGKFQPSLILWQVPEDPCDVKG FCGLNSYCTWDDNKPNCRCLPGSDYADSNHMTLDCLRNYTQVECKDGKENTSSYHMTTME NMVLEDSAYDQAQMSTLVGGEEVDKKTLENMVKVGLWCIQDEPALRPSMKSVVLMLQGIT DIAIPPCPTATSM


| Top |