Cherry SNP DataBase

Gene information

Gene Pav_sc0002681.1_g050.1.mk
Chromosome name PAV_r1.0chr3
start 22585152
end 22589814
PAV_r1.0 name Pav_sc0002681.1
start 23776
end 28438
direction +
Annotation NR PREDICTED: ankyrin-3
Sequence CDS ATGACGGTCTTCTCCGGCAAGCAGGTGTTTCCAGTGGACTATGAGGCCGAGGTTTCTCAA CGCCTTCTCGAAGCTTCGCTCTCCGGCGATCTGAAATCGGCGTTGGAGTGTATCGCCGAT CCGTTTGTGGACGTCAACTTCGTCGGTGCTGTGTGCCTCAAAACAAAGAAGACCGAGGTG TTATTGCGCGACGAATCGGCGAGCGAAGTCCGCGTCGACTATGAGGAGTTCAAAACCGAC GTCACGGCTCTTTTTCTCGCCGTTCATGCTGGAAGTGTAACTTTGGTGAAGAAACTACTG AGCGTTGGAGCTGATGTAAATCAGAAACTCTTCAGAGGCTTCGCGACAACAGCAGCAGTG AGAGAGGGCCACCTTGAGATTCTGGAGATCCTACTGAAAGCTGGAGCATCTCAACCAGCT TGTGAGGAAGCTCTGTTGGAGGCAAGCTGTCATGGACATGCCAGGCTCGTGGAGCTGCTT ATAGCTTCTGATTTGATCCGGCCCCATATTGCTGTGCATGCTATTGTCACAGCAAGCTGC AGGGGGTTTGTTGATGTGGTGGACACTTTCATGAAGTGTGGTGTGGATGCAAGTGCAGCT GATAGGATGCTGCTTCAGTCATCTAAGCCGTCGCTGCACACTAATGTTGACTGTAGCGCA CTTGTAGCTGCAGTTGTTAGTAGGCAGGTCTCGATTGTTCGTTTGCTGCTACAGGCTGGT GCGAGGACAGATGTGACAGTGAGGCTGGGAGCATGGTCATGGGACACAGCCACAGGGGAA GAATTGCGGGTAGGGGCAGGACTGGCAGAGCCTTATCCCATTACCTGGTGTGCAGTGGAG TATTTTGAAGCAAGTGGTTCTATCTTGCACATGCTCCTCCAACATATTTCCCCTGATACC CCTCATTGTGGAAGAACTCTCCTGCACCATGCTATCCTATGTGGTAATGTAGGAGCCGTT CGTGCGCTCTTACGTTGTGGTGCCAATGTAGAATCACCTGTTAAAACAACTGGAAAGACC ATGTTTAATCCAATACATATGGCTGCCCAGCTTGGCTTGTCAACAATCGTTCAGTGTTTA ATCGACTCTGGATGTGATATAAACTCCAAGACAGATTCTGGTGAGACAGCTCTAATGATC TGTACAAAATATAAGCATGAAGAGTCTCTCAGAGCATTGGCCATGGCTGGTGCTGATTTT GGCATGGTTAATGTTGCTGGTCAGTCCGTCAGCTCAATTGCTGGGACAAATCGCTGGTCC CTTGGTTTTCAGCAAGCATTGATACTTGTAATAAGAGCGGGAAAGATGCCAAGGTCCAGC AACTTTTCTGCATTCTCTTCCCTAATGTTTGCAGCTCAAGCCGGTGACATGGAGGCCTTG AAAGCTGTAGTCGGTTCAGGAGAATTTGACATTGATTATCAGGATGATAAAGGTTTCTCG GCAGTCATGATCACTGCTTTGAAGGGTTACGTGGAAGCATTCCGGTTGCTGGTTTATGCA GGGGCTGATGTAAAGTTGTGTAACAAGTCTGGTGAGACTGCAATTACGCTCTCTGAATTA AGCCAAAACCGTGACCTATTTGAGAAGGTAATGCTCGAATATGCACTAGAAAAGGGCAAT CACTATGCTGGAGGGTTCTATGCTCTGCATTGTGCAGCACGTCGCGGGGACATTGACGCA GTCAAATTGTTAACAAGTAGAGGCTACGATGTGAATGTCCCTGATGGAGATGGTTACACT CCACTCATGTTAGCGGCTAGGGAAGGCTATGGTCCCATGTGTGAACTCTTGATCTCTCAT GGGGCAAATTTGGATGAGAAGAATGCCAAAGGCGAAACACCACTCTCACTAGCAAGGAAG AGTGGTTGCGGTACCAAAAATGATGCGGAGTGTGTGATACTGGATGAGCTTGCTCGCAGA GTGGTGCTAGGTGGAGCCCATGTTTGGAAGCATACCAAGGGAGGGAAAGGAAGCCCTCAT GAGAAAGAGATGAGAATGGTGGGAGCCATAGGGGTGCTGCGCTGGGGGAAGTCGAACCGG AGAAATGTGATATGCCGGGATGCAAAGGTGGGGGCCAGCCCAGCTTTTAGGAGGAATAGG AGGAGCAAGAGTGATGTGGATGAAGCTGGAGTGTTTAGGGTGGTGACTACGAAGAACAAG GAGGTGCATTTTGTGTGTGAAGGTGGGGTTGAAACCGCTGAGCTTTGGGTGAGGGGCATA AAGCTTGTGACAAAGGAAGCTATTTTGGGTAATAAGAGGGAGTCATGA
PEP MTVFSGKQVFPVDYEAEVSQRLLEASLSGDLKSALECIADPFVDVNFVGAVCLKTKKTEV LLRDESASEVRVDYEEFKTDVTALFLAVHAGSVTLVKKLLSVGADVNQKLFRGFATTAAV REGHLEILEILLKAGASQPACEEALLEASCHGHARLVELLIASDLIRPHIAVHAIVTASC RGFVDVVDTFMKCGVDASAADRMLLQSSKPSLHTNVDCSALVAAVVSRQVSIVRLLLQAG ARTDVTVRLGAWSWDTATGEELRVGAGLAEPYPITWCAVEYFEASGSILHMLLQHISPDT PHCGRTLLHHAILCGNVGAVRALLRCGANVESPVKTTGKTMFNPIHMAAQLGLSTIVQCL IDSGCDINSKTDSGETALMICTKYKHEESLRALAMAGADFGMVNVAGQSVSSIAGTNRWS LGFQQALILVIRAGKMPRSSNFSAFSSLMFAAQAGDMEALKAVVGSGEFDIDYQDDKGFS AVMITALKGYVEAFRLLVYAGADVKLCNKSGETAITLSELSQNRDLFEKVMLEYALEKGN HYAGGFYALHCAARRGDIDAVKLLTSRGYDVNVPDGDGYTPLMLAAREGYGPMCELLISH GANLDEKNAKGETPLSLARKSGCGTKNDAECVILDELARRVVLGGAHVWKHTKGGKGSPH EKEMRMVGAIGVLRWGKSNRRNVICRDAKVGASPAFRRNRRSKSDVDEAGVFRVVTTKNK EVHFVCEGGVETAELWVRGIKLVTKEAILGNKRES


| Top |