Cherry SNP DataBase

Gene information

Gene Pav_sc0002842.1_g080.1.mk
Chromosome name PAV_r1.0chr8
start 1954992
end 1958885
PAV_r1.0 name Pav_sc0002842.1
start 63989
end 67882
direction +
Annotation NR PREDICTED: serine carboxypeptidase-like 42
Sequence CDS ATGGGTAGGTGTTGGTTTAGTGGGGTTTTGATTGGGTTAGGGTGTGTGTGGTGGGTGGTG GTTGGTGTGGTGGAGGGATACCCAGCTGAGGATCTGGTGGTGAGGTTGCCTGGGCAGCCA AATGTTGGGTTCAAGCAGTATGCTGGGTATGTTGATGTGGATGTGAAAGCTGGGAGAAGC TTGTTTTACTACTTCGTTGAAGCAGACAAGGAGCCTGACAAGAAGCCCCTCGCTCTTTGG CTCAATGGAGGTCCAGGCTGCTCCTCTATTGGTGGAGGTGCCTTTACAGAGCTGGGTCCA TTTTATCCTACAGGTGATGGTAGAGGCCTCCGAAGAAATTCAATGTCATGGAATAGAGCA TCAAATCTCCTCTTTGTTGAGTCTCCTGCTGGAGTAGGATGGTCATACTCGAATACAAGT TCGGATTATAATTCTGGTGATGCGTCCACTGCAAGGGATATGCACACATTCTTGTTGAAA TGGTATGAGAAGTTTCCAGCTTTCAGATCTCGGGAGTTGTTTCTTACCGGAGAAAGCTAT GCAGGGCACTACATACCGCAATTGGCTATAGCTATATTGGACCATAATGAACATTCAACT GGTTTCAAGTTCAATCTGAAAGGGGTTGCTATTGGCAATCCACTGCTGAGACTTGATCGT GATATTCCGGCAACGTATGAATACTTTTGGTCTCATGGAATGATTTCTGATGAAATTGGC CTCACTATCATGAACGAATGTGATTTTGATGATTATGTATTTCAAAATCCTCACAATGTA ACCGTTAAGTGCAACACTGCAATATCTCAAGCAAATCAAATAGTTGGTGAGTATATAAAC AATTACGACGTGATCCTTGATGTTTGTTATCCGTCTATAGTGCAGCAAGAGTTGAGACTA CGGAAAATGGCTACTAAGATAAGCCTCGGAGTTGATGTATGTATGACCTCTGAAAGATAT TTTTATTTGAACCTTCCTGAGGTTCAGAAAGCCCTTCATGCAAATCGTACAAACTTGCCT TATAGTTGGAGTATGTGCAGTCATGTTCTTAATTACAGTGATACTGATGATAACATCAAC ATTCTTCCCTTGCTCACAAGGATAGTTCATAATCGTATACCAGTTTGGGTTTTCAGTGGT GATCAAGATTCTGTTGTACCATTATTGGGTTCCCGAACACTTATCCGGGAACTAGCACAT GATCTAAAGTTCCAGATAACAGTCCCATATGGAGTTTGGTTTCACAAAGGCCAGGCGGGA GGTTGGGCTACAGAGTATGGAGATCTATTGACTTTTGCCACAGTAAGGGGTGCTGCCCAT ATGGTTCCATATGCTCAACCATCAAGAGCATTGCACCTGTTCAGTTCATTCATTCGTGGC CGGAGATTGCCCAACACAACGATTCCTTCCATTTACGATTAA
PEP MGRCWFSGVLIGLGCVWWVVVGVVEGYPAEDLVVRLPGQPNVGFKQYAGYVDVDVKAGRS LFYYFVEADKEPDKKPLALWLNGGPGCSSIGGGAFTELGPFYPTGDGRGLRRNSMSWNRA SNLLFVESPAGVGWSYSNTSSDYNSGDASTARDMHTFLLKWYEKFPAFRSRELFLTGESY AGHYIPQLAIAILDHNEHSTGFKFNLKGVAIGNPLLRLDRDIPATYEYFWSHGMISDEIG LTIMNECDFDDYVFQNPHNVTVKCNTAISQANQIVGEYINNYDVILDVCYPSIVQQELRL RKMATKISLGVDVCMTSERYFYLNLPEVQKALHANRTNLPYSWSMCSHVLNYSDTDDNIN ILPLLTRIVHNRIPVWVFSGDQDSVVPLLGSRTLIRELAHDLKFQITVPYGVWFHKGQAG GWATEYGDLLTFATVRGAAHMVPYAQPSRALHLFSSFIRGRRLPNTTIPSIYD


| Top |