Cherry SNP DataBase

Gene information

Gene Pav_sc0002870.1_g070.1.mk
Chromosome name PAV_r1.0chr1
start 16231949
end 16236026
PAV_r1.0 name Pav_sc0002870.1
start 29690
end 33767
direction -
Annotation NR PREDICTED: helicase SEN1-like
Sequence CDS GTGACGAAAATTCCAGAGACATTTTCGACCGTGGCGGGTTACATGAAGTCATTCATTCCT TCACTTATTGAGGAAACACATGCTGATTTACTCTCAAACGTTACGGCAATTTCGCAGGCA CCTATTTGTGAGATTCTGACTGTTGAAACTTCTAAACATCATAGGCCTCCCAAAGACTTG TTTTATGAAATTACAGTCAGGAAGATGATTGCGACAGAAAGCAATGCAGGAAAATATGAG CCAGCGGTTGGAGATATCTTTGCCTTGACAAATATTAGACCAAAATGCATTGATGATTTG AACAGGCCTACAAATTTCTACCTTATTGCATATGTTCTCGGATCGAAAGATGGAAGCTCA GACAATCTCCAGATACTCTCATCAAAGCCTATCAATGGGGAAGGATACAAGCAAATAAAG AGCAAGAGAGAAACACTGTTTGCTGTCTATTTGATGAACATGACCACAAATGTTCGTGTA TGGAAAGCGCTGAACTCAGAAAAGACAAACACCAATATCATTAAGAATGTGCTGCAAGTG CAACCCAGTTCATCTGATGGGGAGAATTCTTGCACAACCTGTTTTTCCAAACACATGTGC TTCCCTGACCTTTCTACAAAATGGCCCACAATGTGCTCTGATCTAAATGATTCCCAAAAG GCTGCAGAAAAGAGGGAACAGCACAAAAAGAATGATGAGCACGATGAAGAAACTGATAAT AGCAGCTCAACAAGTGATCATGAGAGTGATCTTTTGACGTTTGAAGAGTTTGTGAAGAAA AAATTTGATTACTTTAGTGAGAATCTGAAAACTTGTATGGTAAACTTGTACACCCACTTG CCAACATCTTGCATTTCACTTGAGGTGGTTTGGTTCGCCAAGGAATTTAGGAATTCAATA GCAGAAATTAAAGACACCGAGATTCGACAGGGCGTAATTTCTTTAATAAAAAAGCTTTCT AATGGTTGGCGCCAATCTCAGAATGATAAAGTGATTATAGGCCGGTCAATGTTGTTCCAA ATAGATGGCCAGCAGATTCTAGCAGCTGCGACGAAGCTGATCCAACGGAGTTCCTTTCAA AACCATTTTCTTCACTCAAATGAGTGGAACCAAGGGCACCGGATCGAGGCCAAGATGGTA GTTAATGTTGCTTATTTAATGACAGTGTGTGCAGCAGCAGCAGCAGTAGCAGGAGGCAAG GTCTTTCAGCTGTATGTTGGAAAGTTGTAG
PEP VTKIPETFSTVAGYMKSFIPSLIEETHADLLSNVTAISQAPICEILTVETSKHHRPPKDL FYEITVRKMIATESNAGKYEPAVGDIFALTNIRPKCIDDLNRPTNFYLIAYVLGSKDGSS DNLQILSSKPINGEGYKQIKSKRETLFAVYLMNMTTNVRVWKALNSEKTNTNIIKNVLQV QPSSSDGENSCTTCFSKHMCFPDLSTKWPTMCSDLNDSQKAAEKREQHKKNDEHDEETDN SSSTSDHESDLLTFEEFVKKKFDYFSENLKTCMVNLYTHLPTSCISLEVVWFAKEFRNSI AEIKDTEIRQGVISLIKKLSNGWRQSQNDKVIIGRSMLFQIDGQQILAAATKLIQRSSFQ NHFLHSNEWNQGHRIEAKMVVNVAYLMTVCAAAAAVAGGKVFQLYVGKL


| Top |