Cherry SNP DataBase

Gene information

Gene Pav_sc0002893.1_g310.1.mk
Chromosome name PAV_r1.0chr1
start 20069407
end 20080546
PAV_r1.0 name Pav_sc0002893.1
start 112174
end 123313
direction -
Annotation NR PREDICTED: LOW QUALITY PROTEIN: alpha-glucan water dikinase, chloroplastic
Sequence CDS ATGGATTCTTTGGTTTCTTCAGAATTGAGGAGGGTATCAACGAACATGAGCAATTCGGTA GGCCATAGCTTGCTTCAAAGCAAGATAAATTCTTCTGGTATTCCTGCTAACACATTATTT CAAGCCAAGAGTGTCCACCAAGTGGCAGCACAGGCACGGAAGTCACCCATATCCAAGAAA TTTTGTGGGAACAATTTGAACGTCCAGAAACCCAAGTTAGCCATGGGGTCACGCCGCCCT GCTACAGCCGTTCCTCGCGCTGTATTAACCACAGATCTGCCTTCCGATCAGCAGCTTGCA GGGAAATTCAATCTTGGTGGGAATATTGAATTGCAGGTTTATGTGAATGCATCGTCTCCA GGGTCTGCCACTCAAGTAGACATTCGGGTAACATACAGCGGTCACTCTTTGACTCTTCAC TGGGGTGGGATACAAGATAGAAAAGAAAAGTGGGTGCTTCCTTCTCAGCGCCCAGATGGG ACCAAAGTATATAAGAACAAAGCTCTTAGAACTCCTTTTCAAAAATCTGGCTCCATTTCC TTGCTCAAAATTGAGATTGATGATCCTGCAATACAAGCAATCGAGTTTCTTATAGTTGAT GAAAGCCAGAACAGATGGTTTAAGAACAATGGTGATAACTTTCATGTTAAGTTACCTGCG AAAGAGAAGCTGATATCCAATGCTTCAGTTCCTGAAGAACTTGTGGAGTATGAAGCAGCC CGAAGTGAGCTATTGGAGGAAGTAGCTAGGGGTACGTCCATACAAGATCTCAAAGTGAGG CTGACTAAGAAAAATGATGGTGGTAAAATTGAAGAACCATCTCTTTCTGAGACAGAGAGG ATTCCTGAGGATCTTGTACAAATACAATCTTATATACGCTGGGAGAAAGCTGGGAAACCC AACTACTCCCCAGAAGAGCAACTTGTAAATTCCAAATCTCCTTTGAGCTTCTTGAGGGAA TTTGAGGAAGCAAGACAAGAGTTGCAGAGGGAACTAGAGAAAGGTTCCTCTCTTGATGAG ATAAGGAAGAAGATTACCAAAGGAGAGATACAAACAAAGGTTGCAAAGAAATTTGAGAGT AAACAGGTTTTTAGAACCGCCAGAATACAGCGCAAGAAGAGGGACTTTATGCAGATTATC AATAAACATGCTGCTAAAATTGTAGATGAAGCTAAAATTGTAGATAAAGAACATTCAGTC AAACCAAAACCTTTGACAGCAGTTGAGCTTTTCGCCAAGGCAAAGAAAGAACAGGATGGT GGTTCTGTTCTGAGGAAATATACTTTCAGGCTCAATGATAAGGACCTCCTGGTACTTGTA ACCAAGCCTGCTGGAAAGACAAAGGTTCATCTTGCAACAGATTTCAAAGAACCACTTACC CTTCACTGGGCTTTATCTGAAAACAAGGCTGGAGAGTGGTCGGAACCACCTCCAAATGCA CTTCCCCAGGGTTCAGTTTCTCTAAAGGGGGCCGCTGAAACACAATTTCAAAGTTCTGCT GACCCTACTTATGAGGTTCAATATTTAGAAATAGAAATCGAAGAGGAGAGTTTCAAAGGA ATGCCATTCGTTCTTTGTTCTGCTGGAAATTGGATTAAGAATCAAGGCTCGGATTTCTAT GTTGACTTTGGTGTTGAACTCAAGAAAGTTCAGAAGGATGCTGGTGATGGCAAAGGTACT GCGAAGGGTTTGTTGGATAAAATAGCAGAGAAGGAGAGTGAGGCACAGAAATCCTTTATG CATCGATTTAACATTGCAGCAGACTTAATCAATCAAGCAAAAGATTCTGGTGAATTAGGT CTTGCAGGTATTTTGGTGTGGATGAGGTTTATGGCTACGAGACAGCTCATTTGGAATAAA AATTACAACGTGAAACCACGTGAGATTAGTAAAGCACAGGACAGGCTCACAGACTTGCTC CAGAGCATTTATGCAAGTCATCCACAGTATCGAGAACTTCTACGTATGATTATGTCTACT GTTGGCCGTGGAGGAGAAGGGGATGTGGGACAGCGAATTCGAGATGAGATCCTTGTCATC CAGAGAAACAATGAGTGCAAGGGCGGAATGATGGAGGAATGGCATCAAAAGTTGCATAAT AACACTAGTCCAGATGATGTTGTTATTTGTCAGGCATTATTGGATTACATAAAAAATGAC TTTGATATTGGTGTTTACTGGAAAACATTGAATGATAATGGAATCACAAAAGAACGTCTT CTAAGCTATGATCGGGGAATCCATAATGAACCCAATTTCAGGAGAGATCAGAAAGAGAGT CTTCTGCGGGATTTGGGGCACTACATGAGAACTTTGAAGGCAGTTCATTCAGGTGCAGAT CTTGAATCTGCCATTCAAAATTGTATGGGCTACAAATCTGAGGGTCAAGGATTCATGGTT GGAGTAAAAATAAACCCTATATCTGGCTTGCCATCTGAGTTTCCAGACCTCCTGCGATTT GTACTAGAACATGTTGAAGACAGAAATGTGGAAGTCCTTATTGAGGGTTTGCTTGAGGCT CGCCAGGCGCTTTGGCCATTGCTCTCTAAGCCTCATGATCGTCTGAGGGATCTATTATTT TTGGACATTGCCCTTGATTCTACTGTCAGGACTGCTATTGAGAGGGGATATGAAGAACTG AACAATGCTGGGCCAGAGAAAATTATGTACTTCATCTCTTTGGTTCTAGAAAACCTGGCA CTATCGTCAGATGATAATGAGGACCTTGTTTACTGTTTGAAGGGGTGGGATCGTGCTATA AACATGTTAAACAGTAACAGCGATGACTGGGCATTATGTGCAAAATCAGTCCTAGACAGA ACCCGCCTTGCACTTGCAAACAAGGCAGAATCGTATCTCAGTGTTTTACAGCCATCAGCA GAGTACCTTGGATCACAGCTTGGAGTGGACCAATCAGCTGTGAACATATTTACTGAAGAA ATTATCCGTGCTGGATCAGCTGCCTCTTTGTCCTCGCTCCTTAATCGACTGGATCCAGTT CTTCGAAAGACTGCTCATCTGGGAAGCTGGCAGGTTATCAGCCCACTGGAAGTGGTTGGA TATGTGGTCGTTGTGGATGAATTACTCACTGTTCAGAATAAAGTTTACAGCAAGCCCACA ATTTTGGTGGCAAAAAGTGTAAAAGGTGAGGAAGAAATTCCAGATGGTACTGTTGCTGTG CTGACACCTGATATGCCAGACGTCCTATCTCATGTCTCTGTCCGAGCAAGAAATAGCAAG GTTTGTTTTGCAACATGCTTTGACCCCAATATTCTGGCTGACCTCCAAGCTAGTGAAGGG AAGTTACTACGTATAAAGCCAACACCTGCTGATATAACTTATAGTGAGGTTAATGAGGGT GAGCTAGAAGATGCAAGTTTAACTCATTCAACAGAAGACACTCCATCTCTGACATTGGTC AGGAAACAATTTACTGGTAGATATGCCATATCATCTGATGAGTTCACAAGTGAAATGGTT GGAGCTAAATCACGTAATATTTCTTATATAAAAGGAAAACTGCCGTCTTGGATTGGAATT CCTACATCAGTTGCCCTACCATTTGGAGTATTTGAGAAGGTTCTTTCAGAAGATTCAAAT AAGGCAGTGGCTGAAAAGTTGGGAACTCTAAAGAAAAAGTTAAAAGGTGAAGATTTTGAT TCGCTTAGGGAGATTCGGGAGACCGTTTTACAGCTGGCAGCACCACCCCAGTTGGTCCAA GAGCTGAGGACTAAGATGCAAAGTTCAGGAATGCCTTGGCCTGGTGATGAAGGTGAACAA AGGTGGGAACAAGCATGGATGGCTATAAAAAAGGTCTGGGCTTCAAAGTGGAATGAGAGA GCATACTTCAGCACAAGAAAAGTGAAATTAGATCATGATTATCTCTGCATGGCTGTCCTT GTTCAAGAAATCATAAATGCTGACTATGCATTCGTTATTCACACGACTAACCCATCATCA GGAGACTCATCAGAGATATATGCTGAGGTTGTTAAGGGACTTGGGGAAACCCTGGTTGGA GCTTATCCTGGACGTGCTCTAAGTTTTATTAGCAAGAAGAATGATCTGGACTCACCCCAG GCTTTCACAGACCCTACTAATCCTATCACAACCATTGTTCCTATGGATGAGGAAGAGAAA GTTGTGCTTGACTATTCATCTGACCCACTGATGGTTGACGGAAACTTTCGCAAGTCAATC CTCTCTAGCATTGCTCGTGCCGGAAGTGCAATTGAGGAGCTGTATGGGTCTCCACAAGAC ATTGAAGGTGTGATCAGGGATGGGAAACTCTATGTTGTCCAGACAAGACCCCAAATGTGA
PEP MDSLVSSELRRVSTNMSNSVGHSLLQSKINSSGIPANTLFQAKSVHQVAAQARKSPISKK FCGNNLNVQKPKLAMGSRRPATAVPRAVLTTDLPSDQQLAGKFNLGGNIELQVYVNASSP GSATQVDIRVTYSGHSLTLHWGGIQDRKEKWVLPSQRPDGTKVYKNKALRTPFQKSGSIS LLKIEIDDPAIQAIEFLIVDESQNRWFKNNGDNFHVKLPAKEKLISNASVPEELVEYEAA RSELLEEVARGTSIQDLKVRLTKKNDGGKIEEPSLSETERIPEDLVQIQSYIRWEKAGKP NYSPEEQLVNSKSPLSFLREFEEARQELQRELEKGSSLDEIRKKITKGEIQTKVAKKFES KQVFRTARIQRKKRDFMQIINKHAAKIVDEAKIVDKEHSVKPKPLTAVELFAKAKKEQDG GSVLRKYTFRLNDKDLLVLVTKPAGKTKVHLATDFKEPLTLHWALSENKAGEWSEPPPNA LPQGSVSLKGAAETQFQSSADPTYEVQYLEIEIEEESFKGMPFVLCSAGNWIKNQGSDFY VDFGVELKKVQKDAGDGKGTAKGLLDKIAEKESEAQKSFMHRFNIAADLINQAKDSGELG LAGILVWMRFMATRQLIWNKNYNVKPREISKAQDRLTDLLQSIYASHPQYRELLRMIMST VGRGGEGDVGQRIRDEILVIQRNNECKGGMMEEWHQKLHNNTSPDDVVICQALLDYIKND FDIGVYWKTLNDNGITKERLLSYDRGIHNEPNFRRDQKESLLRDLGHYMRTLKAVHSGAD LESAIQNCMGYKSEGQGFMVGVKINPISGLPSEFPDLLRFVLEHVEDRNVEVLIEGLLEA RQALWPLLSKPHDRLRDLLFLDIALDSTVRTAIERGYEELNNAGPEKIMYFISLVLENLA LSSDDNEDLVYCLKGWDRAINMLNSNSDDWALCAKSVLDRTRLALANKAESYLSVLQPSA EYLGSQLGVDQSAVNIFTEEIIRAGSAASLSSLLNRLDPVLRKTAHLGSWQVISPLEVVG YVVVVDELLTVQNKVYSKPTILVAKSVKGEEEIPDGTVAVLTPDMPDVLSHVSVRARNSK VCFATCFDPNILADLQASEGKLLRIKPTPADITYSEVNEGELEDASLTHSTEDTPSLTLV RKQFTGRYAISSDEFTSEMVGAKSRNISYIKGKLPSWIGIPTSVALPFGVFEKVLSEDSN KAVAEKLGTLKKKLKGEDFDSLREIRETVLQLAAPPQLVQELRTKMQSSGMPWPGDEGEQ RWEQAWMAIKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSS GDSSEIYAEVVKGLGETLVGAYPGRALSFISKKNDLDSPQAFTDPTNPITTIVPMDEEEK VVLDYSSDPLMVDGNFRKSILSSIARAGSAIEELYGSPQDIEGVIRDGKLYVVQTRPQM


| Top |