Cherry SNP DataBase

Gene information

Gene Pav_sc0003033.1_g030.1.mk
Chromosome name PAV_r1.0chr2
start 1031854
end 1034655
PAV_r1.0 name Pav_sc0003033.1
start 15183
end 17984
direction +
Annotation NR PREDICTED: dentin sialophosphoprotein
Sequence CDS ATGGTCCAAAGAAAGGTACCAAGCAAGCTTGGAATCCAAGCTGATCATGTTAAATTCGAG AAGCGGTTGGCGAACCTGAAAACATCTTCTCAGTTCCAGGATGGCAAACACAGGGGAGCT GATTTGAAGAAAAAAATGAAGAAATCTAGATCAATCAAGCTTTCAGATATTGAGAGCTTG AGATCATCACCTTTGAGAAAGAACATATCCCAGCCAGGAAAGCCACCACCACCAGCTCTC AATGTTCCAAACACTGCAGCTTTTCCTCAGAAGCAGCCCATGAACAAAACAACTTATGGC TCACCAAACTATATGAAGCCCACCAGCTGTTCTGATGCAAGGAAGGAGCAATCCCTGGTT AGCGTTCGAAATTCTCCGACTATATTTTCGGATAGTAAGAACGAGCACCGAAGAAATTCG AGCAGTTCAAAGCTTAGCTCTGCTTCTAATCATAAACCAGAAAGAACTTCAACAAGGACG TCTAGTTTGAAGCTGGTGAGAACATTAATAAAGTCCCCCAGTTTTAAGCCAGCAAGAGGT TCAGCCAAAAAATCTTCCAGGGTTGCTCTTTGTGCAGATATGAATGTTCAGAGAGCAACT TGTTCTTCAACACTTAAGGATACAAAGTTTCCTGATTATCTGGTGATTAATCCTGGGGGA ACTGAAGCTGAGGGGACTTCAGTCATGAAGGTTTGCCCATACACTTACTGTTCTCTCAAT GGTCATCATCATTCACCTGTGCCTCCATTGAAGTGTTTCTTGTCTGCAAAAAGACGTTCG TTGAAGACCCAGAAGATGATGAAGCTGCAAGCTCTAAGTCCACGTGGAGCGAAGCAATCT AATGATGGAGTAAAAGAAATTGATTTGCAGAGGATGTTGTTTGATGACAATGACAAAAAT GCTGATCCTATGAAACATGAAGATTTCTTTGTTGAAATCTATGCTACACGCAAGGAAGAC GATGCTGAGGAAATTGGAAGGGAAGCTGGAGCTGATCTTGTAGGAGAACAAGATGATTCC AACGGTGAACCAAATGATGCAAGTGGTGAAGCAGCAGAAGAAAATAATGCGAACACCCTA GTTGAGGAGAATCTGTCGGATAGATCACCGCAGTCTGAGAGTGACTCTGAGGCAGAAAGC TTTGAAGGCTTTGCTGAAGAAGACCAAAAAGAAGATATAGATGAATACTACAAAGCTCTG TTGGATCAAGAAGAAGCTACCATGGGAAGCAGTTCGAATGAGAGCGACTTTGAAGAACTT TCAAGCATCGAAGTGCATTATGCCAGTTCCACAACTACTGACATGGAGTGGGAGGAAGGG CGATTGTCCACTGGAGTGCTTGATGATTATGAGTCTGGTCCAAATGCTGGGTTTTCATCA ATAATTCGAGATGCTGATATGCATGAAGAACCTCTGATCAAGTCTGATGCAATTTCTGGT AACTGCATTGATGTGATAGAGGATTATTATGAAGTACTGCAAGGACTTTTGGAAGAGAAA AACCAGTCTTTTGAGAGACAACTCAACGATGGTGGCGGCAGTGAACGGGATGACACTAAA CAGAATTTTGAGATTCAAGAATCTGAACAAGGGTATGACAGATTGAGTTATGACCAACTT TCTTACAGCGATGATGCATTCGAAGAAGACAGTGACCTATCAGAGACAGATTGCAGAGAG TTATCTTCATCTTCAGCAGAGGAGTCGATTGAGCAGCTAACAGAAACTGGTGTGGAAATT CAAGAGCAGAGTGGAGTTAAAGCAGAGGATCATGACATCAATTCTTGCCTTGGAGATGTT GAAAGCAACTGCACCAATGTGGAGACAGATGAAACTTCAGGTAACCAACCCAAAAATACA TTTCAAGATGATGAAATAAGTACATTGACAGGAGACCAAGTTTTTAATGCCTCTAAGAAT ATGAGGGAAACAGATAAGGCTGAAACAATTGAAGGATGCACCGGGAGCCTGGATAAAGAG AATTCGGAAACAGATCAAAATGTTGCAACCAGTGACGCTGTCTTGTCACAGGAACTCACT GCAATGGTTGCTGGGAATCAAATGGAAGAGACAGAGCAAGCTGATGACTCCAAATCATCA GAACAAATCCAGCTTTCTGATGAAGATGCTTTCAAGATTGAAGATCATGAAAACTGCAAG AAGACTGAACCCTTCCAGCTTAATGATAGTGCTGAAGTTGGCAACCAGTCTGGAGGGAAG TACAAGAAGCCAAAAATTTCAACTTCCATTGAATCTGAGGATCAGGGTGATTTAAGGCTG AACAACAGATCAGGTCCCTCAGAAAACAGCACAGGAGAACCTCACGATATGGAAGTGGAA AACAATTCAGAGCCAGATGCAACAGAAACTTTCATGGCCAATAATGGTATTAGCCCTGGG CTGAAGAGAAAATTTTCCCATGGAGAAAGCAATTCCAACCAAGAACTTCCTGACACCTGC AACTACCGAAGAGGAAGCAAATTCAAGAGACTTAGCGTGGAGGAGGAACAAAGGAAGTAC AATCCAAGAGAACCAAATTATCTGCCTGTGGTTCCTGATCCTGAAGCAGAAAAGGTTGAC CTCAGGCATCAGATGATGGACGAAAAGAAAAATGCAGAGGAGTGGATGCTTGACTTTGCA CTCCAACAGGCTGTAACAAAACTTGCTCCAGCGAGGAAGAAGAAAGTGGCATTGCTTGTT GAAGCTTTCGAAGCGGTCATGCCAGTGCCCAAATGTGAAACAAGTCGCAGGCATACTTCA GCAGCCTTCAATCAGGCAAGGCCTATGCAAGCTTGTAGCTGA
PEP MVQRKVPSKLGIQADHVKFEKRLANLKTSSQFQDGKHRGADLKKKMKKSRSIKLSDIESL RSSPLRKNISQPGKPPPPALNVPNTAAFPQKQPMNKTTYGSPNYMKPTSCSDARKEQSLV SVRNSPTIFSDSKNEHRRNSSSSKLSSASNHKPERTSTRTSSLKLVRTLIKSPSFKPARG SAKKSSRVALCADMNVQRATCSSTLKDTKFPDYLVINPGGTEAEGTSVMKVCPYTYCSLN GHHHSPVPPLKCFLSAKRRSLKTQKMMKLQALSPRGAKQSNDGVKEIDLQRMLFDDNDKN ADPMKHEDFFVEIYATRKEDDAEEIGREAGADLVGEQDDSNGEPNDASGEAAEENNANTL VEENLSDRSPQSESDSEAESFEGFAEEDQKEDIDEYYKALLDQEEATMGSSSNESDFEEL SSIEVHYASSTTTDMEWEEGRLSTGVLDDYESGPNAGFSSIIRDADMHEEPLIKSDAISG NCIDVIEDYYEVLQGLLEEKNQSFERQLNDGGGSERDDTKQNFEIQESEQGYDRLSYDQL SYSDDAFEEDSDLSETDCRELSSSSAEESIEQLTETGVEIQEQSGVKAEDHDINSCLGDV ESNCTNVETDETSGNQPKNTFQDDEISTLTGDQVFNASKNMRETDKAETIEGCTGSLDKE NSETDQNVATSDAVLSQELTAMVAGNQMEETEQADDSKSSEQIQLSDEDAFKIEDHENCK KTEPFQLNDSAEVGNQSGGKYKKPKISTSIESEDQGDLRLNNRSGPSENSTGEPHDMEVE NNSEPDATETFMANNGISPGLKRKFSHGESNSNQELPDTCNYRRGSKFKRLSVEEEQRKY NPREPNYLPVVPDPEAEKVDLRHQMMDEKKNAEEWMLDFALQQAVTKLAPARKKKVALLV EAFEAVMPVPKCETSRRHTSAAFNQARPMQACS


| Top |