Cherry SNP DataBase

Gene information

Gene Pav_sc0003087.1_g030.1.br
Chromosome name PAV_r1.0chr2
start 280797
end 282797
PAV_r1.0 name Pav_sc0003087.1
start 11136
end 13136
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103929856
Sequence CDS ATGGTGATGCATGCGCTCATGACTCGTGGAGCAGCTTGTGCGGCTCCAGGCTCATCTTCT TCCGCCAATCCTTTCGATGCTTTAGGCAACGCTCTTATCGACGCTCATGGCCACATGCTG CACCAGATCCGAGAGAAGGCTCACAAGGATGAGCTTAAGAAGAACGAAGAGACCATTTCA AGGTCAGCCGAATCATATTGTTATGATTCGGGGTCAGTTTGGCCACTGGGCTTTTTGATG AAGTATTGCTCTATGCTACGAAATCGTATGCTGGCTGATCCTTCCTTTCTTTTTAAAGTT GGGACAAAGATAGTCATAGATTCTTGTTGTGCAACATTTGCAGAAGTTCAAAAAAGGGGA AAGGATTTCTGGGCTGAGTTTGAGTTGTACGCTGCTGATCTTTTGGGGCAATCTGTCATA TCAGTGGATGATAAATTGAAAATCATAGCCTGCAGGGAACAACATAAGAAATTATCAGCT CTTCAGATGGAGTTGGCTGCAGTTAGACATGAGGGTTTTACTTCAATGCGCTCCATAGAG ATTAATGGAACTGATTATAAGAGAATGCCACTAGTGGTGATTGGAATTTTTACAACCTTT GGTCGCAAAAACAATAGAGACACCATTCGTAAGGCGTGA
PEP MVMHALMTRGAACAAPGSSSSANPFDALGNALIDAHGHMLHQIREKAHKDELKKNEETIS RSAESYCYDSGSVWPLGFLMKYCSMLRNRMLADPSFLFKVGTKIVIDSCCATFAEVQKRG KDFWAEFELYAADLLGQSVISVDDKLKIIACREQHKKLSALQMELAAVRHEGFTSMRSIE INGTDYKRMPLVVIGIFTTFGRKNNRDTIRKA


| Top |