Cherry SNP DataBase

Gene information

Gene Pav_sc0003098.1_g010.1.br
Chromosome name PAV_r1.0chr1
start 8324520
end 8327907
PAV_r1.0 name Pav_sc0003098.1
start 1335
end 4722
direction -
Annotation NR PREDICTED: wall-associated receptor kinase 2-like
Sequence CDS ATGGCCTTGCATGGGAGGATGCTGCTCATTGTGCAAGCCTCTTTGGAAATGGTGGCAGTT GTAATATTAGCTGCTGCAACAATAGCAGCTCTGCCTCAAGCCCTGCCTGGTTGCCAAGAG AAATGTGGTAATCTCACAATCCCATACCCATTTGGCATAGGAAAAGGGTGTTCCATGGCT GGAGAATACTTTAATCTCACTTGTAATACGTCCACTGTCCCCCCTACAACATACTGGGGT AACGTGACTGTTACCAACATATCCCTTCCTGATGCCGAGATGCAAACCCAGCAGTTCGTT GCGAAAGATTGTTATGACACCGAGGGTCAGAGTACCAGCAACCTCATCGCTACGCTCCAG GTGCCTCTTCCTTTCACAATCTCTGATACCAAAAACAATTTGGTAGCCATTGGTTGTGAT ACTAATGTAATTTTCGAAGGTTACCGAAATCAAACCATGTTTGCCACTGGGTGCACGGCC TGGTGCGATGGCCTTGGCAGCGTTGATCAGGACACTTGCTCTGGCGCTGGTTGTTGTGAA ACTAAGATCCCCAGTGGCCTGTACAGTCAAACAGTCGAATTGAAAAGCTATAACAATTAT AAATTTGTAAAGGACGTCAACGCCTGCAGCTATGCCTTCGTTGTGGAGCAAGACCAGTTC AAATTCTCCAAAAAAAGTTTTCAAGAGCTGAGCACAAAAGAGACGATTCCAATGGTTGTT AATTGGGCAATTGGGTATGACCCAGAACCTTGTGATACAGCTCGAAAGAGCCCGCATTAT GCATGCAAGGCGAATACCACATGTGCCAACCGCCCCAATCAGTCTGGTTACATTTGCCGA TGTTTGGAAGGTTACCAAGGAAACCCGTACCACCCAAATGGTTGCCAAGATATTGATGAA TGCGCCCGAAAAAACCCCTGCACCAATGGAAAGTGCCTGAATTCACCTGGAAATTACTCT TGTTCATGTAATAAAGGATTCAAAAACCAAGACCCCAGGACCTGCGTCAAACATTCCGCA GCAGACAACACAACCAAAAAAGTTTTATTCGCTGTTGTTGGGAGCTTCGGTTTTTTACTG GCGGTTGTAGTTTCATTGATGCACTACATGAAGAGGAGGAAGCTCAGTAAACTTAAAAAA GAATACTTTGAGAGAAATGGTGGCTTATTTTTACAAAACCAACTGAAGAGGTACAATGGA CGTGTTGATAATACACCCAGACTCTTTACGGATAAAGAACTTCAGAAAGCCACAAACAAC TACCATGAAGATAGAATAATTGGTGAAGGGACCTATGGGATCGTATACAAAGGAATACTG GAAGATGAAAAAGTGGTTGCCATAAAACAATCCAAACTTCCAACAAGCCCAGGCCAGAGT AATCAGCTTGTGCATGAGGTGATTGTTGTTGCCCAAATCAACCATAAAAATGTTGTGAAG CTCCTGGGTTGTTGTTTAGAGACCCAAAGGCCTTCACTGGTTTACGAGTACGTCTCCAAT GGCACTCTTTACGATCAAATTCATAAAAAAGGCGGCAAACGCCGACCACTTTCATTTTCG TTACGACTGAAGATAGCCTCTGAAACTGCACAAGCGCTATCATATTTGCACTACTCCAGT CGAACACCAATTATACATAGAGATGTGAAAGCGATGAATATATTGTTAGACGAGAATTAT GTGGCCAAAGTTTCAGACTTTGGAGCTTCAAGATTGGTTCCTGAAGATCAAAATCAAGTA TCAACTCTGGTGCAAGGAACAATGGGATACTTGGACCCCGAATATCTCCAGTCAAACACA CTGACAGAAAAGAGCGATGTTTATAGCTTTGGAGTTGTCCTGGCGGAGCTGTTGACAAGC CAAAAGGCTCTTTCTTTTCAGAAGCCTGAGGCAGAGAGAAACCTAGCAAACTTGTTTGTT TCTTTAGTGGAACAGGGTCGCTTGGATCCAATCCTTGATGCTGAAATAGTAATGGAGGGG CAATTCGAGACGGTCGACAAAGTGGTTGATCTGGCAAAGAGATGTTTAAGCTTAAGAGGG GTTGAAAGGCCTAGTATGAAGCAAGTAGCCATGGAGCTGGAAGAGATCATAAGCAAGGGA AGGCATCCAGCTGCGGGGAAGGCTAATTACTTTACATCTAGATCTCCCAAAGACACCGAC CACTTACTTGGATCACCTGTTTACATTGTTGATCTTGAAGGGAATGATGGTGGTTCTAGT GGCATTATAACCAGTGCAGACTACGACAAAAGCCTGCCAACTCAAATCCATAAGCATTAC GATAATGGGCGATAA
PEP MALHGRMLLIVQASLEMVAVVILAAATIAALPQALPGCQEKCGNLTIPYPFGIGKGCSMA GEYFNLTCNTSTVPPTTYWGNVTVTNISLPDAEMQTQQFVAKDCYDTEGQSTSNLIATLQ VPLPFTISDTKNNLVAIGCDTNVIFEGYRNQTMFATGCTAWCDGLGSVDQDTCSGAGCCE TKIPSGLYSQTVELKSYNNYKFVKDVNACSYAFVVEQDQFKFSKKSFQELSTKETIPMVV NWAIGYDPEPCDTARKSPHYACKANTTCANRPNQSGYICRCLEGYQGNPYHPNGCQDIDE CARKNPCTNGKCLNSPGNYSCSCNKGFKNQDPRTCVKHSAADNTTKKVLFAVVGSFGFLL AVVVSLMHYMKRRKLSKLKKEYFERNGGLFLQNQLKRYNGRVDNTPRLFTDKELQKATNN YHEDRIIGEGTYGIVYKGILEDEKVVAIKQSKLPTSPGQSNQLVHEVIVVAQINHKNVVK LLGCCLETQRPSLVYEYVSNGTLYDQIHKKGGKRRPLSFSLRLKIASETAQALSYLHYSS RTPIIHRDVKAMNILLDENYVAKVSDFGASRLVPEDQNQVSTLVQGTMGYLDPEYLQSNT LTEKSDVYSFGVVLAELLTSQKALSFQKPEAERNLANLFVSLVEQGRLDPILDAEIVMEG QFETVDKVVDLAKRCLSLRGVERPSMKQVAMELEEIISKGRHPAAGKANYFTSRSPKDTD HLLGSPVYIVDLEGNDGGSSGIITSADYDKSLPTQIHKHYDNGR


| Top |