Cherry SNP DataBase

Gene information

Gene Pav_sc0003098.1_g210.1.br
Chromosome name PAV_r1.0chr1
start 8240118
end 8240591
PAV_r1.0 name Pav_sc0003098.1
start 88651
end 89124
direction -
Annotation NR PREDICTED: LOW QUALITY PROTEIN: phylloplanin-like
Sequence CDS ATGACCTTCAAAACAATTTTTGCTGCAATTGTATGCCTCTTGGTCGCTGCAGTGGCAGTT ACAAAAGCTAAGCCCAATATTGATGAGGATCCCAGGTCCCTACTTGCTGCGTTCTACATA CAAGGGACTGTGTTTTGCACTACCGATGGCAATTTGGGTGACGCCGCCGATCCTTTTCTT ACTCCACCATTCCCAAATGCTACTGTGGAACTGCAATGTGGACCTGCAAATACAACGATT GCTCTTGCGAGAACCATCAAGAACGGAGTGTTTTCAATCTTGCTGGATCCTTTGACGTCC TTTGCTGGCTCTTTGATATCTTCTTGCAGGCTAGTGCTTACCACGTACGCCGCTTTCGAG CTGCAATGA
PEP MTFKTIFAAIVCLLVAAVAVTKAKPNIDEDPRSLLAAFYIQGTVFCTTDGNLGDAADPFL TPPFPNATVELQCGPANTTIALARTIKNGVFSILLDPLTSFAGSLISSCRLVLTTYAAFE LQ


| Top |