Cherry SNP DataBase

Gene information

Gene Pav_sc0003098.1_g250.1.mk
Chromosome name PAV_r1.0chr1
start 8219361
end 8224784
PAV_r1.0 name Pav_sc0003098.1
start 104458
end 109881
direction -
Annotation NR E3 ubiquitin ligase RNF4
Sequence CDS ATGGCCTCACACTCATTAGGGCAATTTACAGAAGGGAAAGTGAGGAATTCTCAAAGGGGG AAGATGCCACTAACTGTGGACCTCAACTATCCAGCTCCTTGTGAGGACATGGTTCTAAAT GCCAGATTTACTTGGGACAATAGTCAACAAGGTCAAGATGAAGCACATAGTCAGTCAGAA CCACAAGCTTCACTTGATTGTGAGGTCATTGATGATGAAGTTGTCATAATTTCCCCAAGG ATATATGCCCAAGCCAAGAATAACTCCAGTAGAAACCTGGAGGTGCGGGATGTGCCTGCT ACCAATACAGAACAGCATAATGGCCTTTCAGATGTGGCTGCTCAAACACATCTAATTCCT CTTCATTGCCACAAGCGTAGAAGAACTTTACGAAATCAAGCAGTTTTAAATTGGGAGCTT CACTTCAGCTCTGATGAAGACAGTGATGAAAACAAGACAAAGGAAGTGCCTATTCCAGAA CTTCCTCAGAGCACGCCACCTCCAGAGACACCCGCCTTCAGTTGCCCAATATGCTTGGGC CCGTTGAGTGAAGAGACATCAACGAAGTGTGGTCACATCTTCTGCAAGATGTGTATTGAA GCCTCAATAAAAGTTCAGCACAAATGCCCAACTTGTCGTAAAAGGCTTAGAATGAAAGAC ACTATAAGGGTCTACCTTCCTACCAAGTGA
PEP MASHSLGQFTEGKVRNSQRGKMPLTVDLNYPAPCEDMVLNARFTWDNSQQGQDEAHSQSE PQASLDCEVIDDEVVIISPRIYAQAKNNSSRNLEVRDVPATNTEQHNGLSDVAAQTHLIP LHCHKRRRTLRNQAVLNWELHFSSDEDSDENKTKEVPIPELPQSTPPPETPAFSCPICLG PLSEETSTKCGHIFCKMCIEASIKVQHKCPTCRKRLRMKDTIRVYLPTK


| Top |