Cherry SNP DataBase

Gene information

Gene Pav_sc0003129.1_g030.1.mk
Chromosome name PAV_r1.0chr2
start 12189725
end 12196140
PAV_r1.0 name Pav_sc0003129.1
start 27068
end 33483
direction -
Annotation NR
Sequence CDS ATGGAGTGTTGGAAGGTGGTGTTTGTGATTTGGATCGTAGAGCATCCAAAACAGTTAAGC ACAGGAAAAAACATAGTAGAAGGAAAAGAAAAAGGGACATCAATCATGATGACAGCGACA ATGAGTTGCTGGATTTGGGAAACACAAAAAATAGGCTGGATTTGCAATCTAATGTTGGAA GTTGGTTGCTCTCAATTGATGAGTATTCTGCATCATGGAACAGTGCCCATCGCCCAGAGA AAGAGTGAATTAGAGCGGCCACTACCAGTGTACAACATTTGGGCGGAAAAGTTTTTGTGG AAACCTGAAAATGCCTTAGCTTGTATCTCAGACACTACCAGAATGCACACAAGGTTTGAC CTGACAGTCAAAGTGACAGAGGATTTACCCGAATATCTTTCCAAGTATTGCTTATCTACA TGGATGAAGTGGGTGTTTGCACAATGGGGTCAGTAA
PEP MECWKVVFVIWIVEHPKQLSTGKNIVEGKEKGTSIMMTATMSCWIWETQKIGWICNLMLE VGCSQLMSILHHGTVPIAQRKSELERPLPVYNIWAEKFLWKPENALACISDTTRMHTRFD LTVKVTEDLPEYLSKYCLSTWMKWVFAQWGQ


| Top |