Cherry SNP DataBase

Gene information

Gene Pav_sc0003135.1_g480.1.mk
Chromosome name PAV_r1.0chr4
start 5110656
end 5113172
PAV_r1.0 name Pav_sc0003135.1
start 236204
end 238720
direction +
Annotation NR hypothetical protein VITISV_002109
Sequence CDS ATGGCTACCGTCTCTCAGTGTTTTGGAGCTACTTCGGCTGCTATATCGGTCTCCTCCAAC TCAAGGAAGCTTCACCTCCCTTCTCGCAGATCCCTCCCAGGGAGGAAAGCGAGCTTCTTT GTTGTCAGATCTGATGCTGGGTCTAAGTCGGCTCTGAATTCAAGAGCTCGTCGGGCCGAT CAGCTAATTACCAATGCTGTTGCAACAAAGGCTGATAGCGCTGCGGCTTCGACGGCATCG AAACCTGGGCACGAACTTCTGCTTTTTGAAGCCTTACGTGAAGGATTGGAAGAAGAGATG GCTAGGGATCCCACTGTATGTGTAATGGGTGAAGATGTGGGACACTATGGAGGATCGTAC AAGGTGACCAAAGGCCTGGCTGATAAGTATGGAGATCTCAGGGTTCTTGATACTCCTATT GCTGAGAACTCCTTTACAGGTATGGGTATTGGAGCTGCCATGACTGGTCTGAGACCAATT ATCGAGGGTATGAACATGGGATTTCTCCTTCTAGCCTTTAACCAGATCTCCAACAACTGT GGTATGCTCCACTACACTTCTGGGGTGATTCTTTTTGAGCATGTGTTGCTATACAATCTC AAGGAGAGAATTCCAGATGAAGAATATGTGTGTTCTCTTGAGGAAGCTGAGATGGTTAGG CCTGGGGAGCATGTCACTATATTGACATACTCTCGGATGAGGTATCATGTGATGCAGGCT GCCAAAACTTTGGTGAATAAGGGTTATGATCCAGAAGTGATTGATATTAGGTCGTTGAAA CCATTTGATCTTCACACAATAGGAAATTCAGTGAAGAAAACACACCGCGTGCTGATTGTC GAGGAGTGCATGCGGACGGGTGGAATTGGTGCTAGCTTGACTGCAGCAATCACTGAGAAC TTCCATGATTATCTAGATGCCCCTATTATATGCCTGTCTTCACAGGATGTTCCCACTCCA TATGCCGCAACATTGGAGGAAGTGACTGTTGTTCAACCTGCCCAGATTGTGACGGCAGTT GAGCAGCTCTGCCAGTAA
PEP MATVSQCFGATSAAISVSSNSRKLHLPSRRSLPGRKASFFVVRSDAGSKSALNSRARRAD QLITNAVATKADSAAASTASKPGHELLLFEALREGLEEEMARDPTVCVMGEDVGHYGGSY KVTKGLADKYGDLRVLDTPIAENSFTGMGIGAAMTGLRPIIEGMNMGFLLLAFNQISNNC GMLHYTSGVILFEHVLLYNLKERIPDEEYVCSLEEAEMVRPGEHVTILTYSRMRYHVMQA AKTLVNKGYDPEVIDIRSLKPFDLHTIGNSVKKTHRVLIVEECMRTGGIGASLTAAITEN FHDYLDAPIICLSSQDVPTPYAATLEEVTVVQPAQIVTAVEQLCQ


| Top |