Cherry SNP DataBase

Gene information

Gene Pav_sc0003135.1_g540.1.mk
Chromosome name PAV_r1.0chr4
start 5064029
end 5072224
PAV_r1.0 name Pav_sc0003135.1
start 277152
end 285347
direction -
Annotation NR PREDICTED: cullin-4
Sequence CDS ATGAGTTTGATGTCTCACCCCACCAAACGCTCCTCAGCCATCAACAACAACACCAGCAGC AGCACCTCCTCCTCTCTCAACCCTTCTTCAGGCCCACCCATGAAAAAGGCCAAGTCTCAG GCCGTCGCCTGTTCCCTCGATCCCAGCAAGAATGGCCTCCACCACCACCACCACCATCAT CCCCACACTCACCCTTCTCAGGACCCCGATAACGACGTCGTATTCGACCCCTCTACCATG GCCCTCGACGAAGATCTCAAGTCCGACGACCCCTCTTCTCGTGCCGTCGCCGCCAATTTG TCCCGCAAAAAGGCCCAGCCCCCTCAGCCTACCAAGAAGCTAGTCATCAAGCTCCTGAAA GCTAAACCCACGTTGCCCACAAATTTTGAAGAGGAAACATGGGCAAAGCTGAAGTCAGCC ATTTGTGCTATATTTTTAAAGAAACCTGATTCTTGTGACTCGGAGAAGCTTTATCAGGCC GTTAATGATCTTTGCCTGCACAAGATGGGAGGAAGTCTTTATCAACGAATTGAAAGGGAG TGTGAAAGACACATAGCTGCAGCACTGCAATCTTTGGTTGGCCAAAGCCCAGACTTGGTG GTTTTTTTATCACTTGTTGAGAGATGCTGGCAAGATCTTTGTGATCAGATGTTGATGATT CGCGGTATAGCCTTGTATCTTGATAGAACTTATGTGAAACAAACACCAAATGTGCGTTCA TTGTGGGACATGGGACTGCAGCTTTTCCGCAAACATCTTTCTCTGTCTCCAGAAGTTGAG CACAAAACTGTCACGGGCCTCTTAAGACTGATCGAGAAAGAAAGATTGGGTGAAGCGGTG GCTAGGACCCTGCTTAACCATCTTTTGAAGATGTTTACAGCCTTAGGAATCTACTCAGAA AGCTTTGAGAAGCCATTTCTTGAGTGCACTTCGGAATTTTATGCCGCTGAAGGTATGAAA TACATGCAGCAAGCAGATGTTCCAGATTACTTGAAGCATGTGGAGACAAGGTTGCATGAA GAACATGAGAGATGTTTAATCTACCTGGATGCAAGTACAAGGAAGCCATTAGTTGCAACA GCCGAAAAGCAGCTTTTAGAACGCCATATACCTGCCATTCTCGACAAGGGATTTACATTG CTGATGGATGGGAATCGAATTGAGGATCTTCAAAGGATGTACACTCTTTTCTCTAGAGTC AATGCCCTTGAATCACTGAGGCAAGCACTTAGTACATACATTCGGAGGACAGGGCAGGGC ATGATCATGGATGAAGAAAAAGATAGAGAAATGGTTTCTTCCCTTTTGGAATTTAAGGCT TCTCTTGACACTATATGGGAAGAAAGCTTTTTCAAGAATGAAGCATTTTGCAACACCATA AAGGATGCATTTGAGCATCTTATTAATCTCCGTCAGAACCGACCTGCTGAGCTGATTGCA AAGTTTTTGGACGAGAAGCTTCGTGCTGGGAATAAGGGTACTTCTGAAGAGGAATTGGAG GGAATGCTGGATAAAGTCTTAGTTTTATTCAGGTTTATACAGGGCAAGGATGTATTTGAA GCATTTTATAAGAAGGATCTTGCGAAAAGACTACTTTTGGGAAAGAGTGCTTCTATCGAT GCAGAGAAATCTATGATTTCCAAGCTGAAGACTGAGTGTGGCAGTCAGTTTACGAACAAA CTCGAAGGAATGTTTAAGGATATTGAATTGTCAAAAGAGATAAACGAGTCCTTCAAACAA TCATCCCAGGCTAGGACAAAGCTCCCGTCAGGGATTGAGATGAGTGTTCATGTCCTTACG ACTGGGTACTGGCCAACATATCCTCCCATGGATGTTAGACTTCCTCATGAATTGAATGTC TACCAGGATATCTTCAAAGAGTTTTACTTAAGCAAGTACAGCGGTAGGCGTTTAATGTGG CAAAATTCATTAGGTCACTGTGTGTTGAAAGCAGAGTTTCCCAAGGGCAAAAAGGAGCTT GCAGTTTCTCTGTTTCAGACTGTTGTGTTGATGCTGTTTAATGATGCTGAGAAGCTAAGC CTTCAAGACATTAAGGATTCAACTGGCATTGAGGACAAGGAACTGAGAAGAACTCTGCAG TCCCTTGCATGTGGAAAAGTTCGCGTCCTGCAAAAGTTTCCCAAAGGGAGAGATGTGGAG GATGATGATACATTTACGTTCAATGACGGATTTACTGCTCCTCTCTACCGCATAAAGGTG AATGCAATCCAAATGAAGGAAACAGTGGAGGAGAACACGAGCACCACTGAAAGAGTGTTT CAAGACCGCCAATATCAGGTTGATGCTGCTATTGTTCGGATAATGAAAACTAGGAAGGTG CTGAGCCACACTCTTCTGATAACAGAACTGTTCCAACAGCTTAAATTTCCGATAAAGCCG GCAGATTTGAAGAAAAGGATTGAAAGCCTGATTGACAGGGAGTACCTAGAACGGGACAAG AACAACCCTCAAATTTACAACTACCTAGCATAA
PEP MSLMSHPTKRSSAINNNTSSSTSSSLNPSSGPPMKKAKSQAVACSLDPSKNGLHHHHHHH PHTHPSQDPDNDVVFDPSTMALDEDLKSDDPSSRAVAANLSRKKAQPPQPTKKLVIKLLK AKPTLPTNFEEETWAKLKSAICAIFLKKPDSCDSEKLYQAVNDLCLHKMGGSLYQRIERE CERHIAAALQSLVGQSPDLVVFLSLVERCWQDLCDQMLMIRGIALYLDRTYVKQTPNVRS LWDMGLQLFRKHLSLSPEVEHKTVTGLLRLIEKERLGEAVARTLLNHLLKMFTALGIYSE SFEKPFLECTSEFYAAEGMKYMQQADVPDYLKHVETRLHEEHERCLIYLDASTRKPLVAT AEKQLLERHIPAILDKGFTLLMDGNRIEDLQRMYTLFSRVNALESLRQALSTYIRRTGQG MIMDEEKDREMVSSLLEFKASLDTIWEESFFKNEAFCNTIKDAFEHLINLRQNRPAELIA KFLDEKLRAGNKGTSEEELEGMLDKVLVLFRFIQGKDVFEAFYKKDLAKRLLLGKSASID AEKSMISKLKTECGSQFTNKLEGMFKDIELSKEINESFKQSSQARTKLPSGIEMSVHVLT TGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGKKEL AVSLFQTVVLMLFNDAEKLSLQDIKDSTGIEDKELRRTLQSLACGKVRVLQKFPKGRDVE DDDTFTFNDGFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKV LSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLERDKNNPQIYNYLA


| Top |