Cherry SNP DataBase

Gene information

Gene Pav_sc0003148.1_g050.1.br
Chromosome name PAV_r1.0chr4
start 11638933
end 11640240
PAV_r1.0 name Pav_sc0003148.1
start 6909
end 8216
direction -
Annotation NR PREDICTED: BAHD acyltransferase At5g47980-like
Sequence CDS ATGGTTTCAGAGATCAAGGTTGAAGTCATTCACAAGGAAACAATTGAACCATCCTATCCA ACTCCTCACCACCTTAAAAAAATCAACCTCTCTGTTTTTGATCAGTTTCAACCCGAAATT TATACCCCACTACTTCTCTTCTATCCCAGTACTAGTGATGAGGGCAATATTGATCACAAA TCTTTGTTTGCTGAAAAATCCAAGCTTCTAAAGAGATCATTATCTGAGGCCCTCACTCAT TTTTACCCCTTTGCAGGGGAATTCGTATATAATGCCTCGATCACCTGCAATGACCACGGT GCTGCATTTCTTGACGCGCAAGTCAACTGTCCCATATCAAAGATTTTGGAGAAACCTGAT TTTGAGGTCCTAAATCAATTTCTTCCAACTGCTATAGAATCCAAACAAGCCGAAGCAGGG TATATTCTACTAGTTCAGGCCAGCTTGTTTGAATGTGGTGGATTGGCAATTGGAGTCAGC ATTCTACATAAGGTCGCCGATGCCTCTACCCTCAGCGCATTCATCAAAAGATGGGCTGCA ATTGCACTTGGCTCGGCAAGTACTACTGATCATGTAGAATTTGGTGTTGCATCTTCTCTT TTCCCTCCCCTGGATTTCTTCAGCTCACCCCAGTTTTCAATAATACTTTCTAACAAAAAC TGTATAACAAAGAGATTTGTATTTGATACCTCAAAGATTGCTGCTCTCAAATCCAAGGCT GCCACCACAGTGCCAAACCCCACAAGGGTTGAAGTAGTGTCTGCGCTCATTTGGAAATGC ATAATACAAGCATCCAGATCAAAGTTCGGTGTTATAAAGCCATCTATGTGGTGTCCGGTT GTGAATATGCGCAAGAGATCGCTGCAGGGCTTGGCAGAAAACATATTGGGGAATTTTGTG TGGGTGTTTGCAGCAATGGCAATGGAAAGTGAGGTAAAATTTGAAAGCTTGGTTGTTAAA CTCAGGAAAGGCATTGAGCAATACAAGGAAAAGTATCCGAATGGTGTTACTGGTGAGGAT ATATTTCAAGCCATTAAAGGGTCTGGCAACCTCGCGGAAAGGGATGATTTAGAAACCAAT ACTTGCAGCAGCTGGTGCAGGCTTCCCTTGTACGAAACAGAATTTGGATGGGGAAAGCCA TCGTGGGTGAGTACTCGTAGTACAGTCAAGAATACAATTATGTTGATGGATTTGAGTGAT GGGGAAGGCATAGAAGCGTCAGTGACGTTGAAAGAAGAAGACATGATCATAATTGAAAGC AATGAGGAGCTGCTTGCATACGCTTCTCTAAATCCAACTGTCATTTAA
PEP MVSEIKVEVIHKETIEPSYPTPHHLKKINLSVFDQFQPEIYTPLLLFYPSTSDEGNIDHK SLFAEKSKLLKRSLSEALTHFYPFAGEFVYNASITCNDHGAAFLDAQVNCPISKILEKPD FEVLNQFLPTAIESKQAEAGYILLVQASLFECGGLAIGVSILHKVADASTLSAFIKRWAA IALGSASTTDHVEFGVASSLFPPLDFFSSPQFSIILSNKNCITKRFVFDTSKIAALKSKA ATTVPNPTRVEVVSALIWKCIIQASRSKFGVIKPSMWCPVVNMRKRSLQGLAENILGNFV WVFAAMAMESEVKFESLVVKLRKGIEQYKEKYPNGVTGEDIFQAIKGSGNLAERDDLETN TCSSWCRLPLYETEFGWGKPSWVSTRSTVKNTIMLMDLSDGEGIEASVTLKEEDMIIIES NEELLAYASLNPTVI


| Top |