Cherry SNP DataBase

Gene information

Gene Pav_sc0003169.1_g060.1.mk
Chromosome name PAV_r1.0chr1
start 10084193
end 10090342
PAV_r1.0 name Pav_sc0003169.1
start 19020
end 25169
direction -
Annotation NR PREDICTED: ARM REPEAT PROTEIN INTERACTING WITH ABF2 isoform X1
Sequence CDS ATGGAGTTGCAGAGGCGCCAGGATCAGAACCACCCGGAGAGGAAGGGGCAAAAGCGGAAA CTGGAGGAGGAAATCGGAGACGAACGAGAGATCTCGGTGAAGTCCGGCGAAGCCAGAAAG GCGCTGCTCAGCGAGGTCAGCGAGCAGGTGAAGGTCCTCAACTCTACGTTCTCTTGGAGC GAAGCCGATCGAGCGTCGGCTAAGCGCTCCACGCACGTCCTCGCCGAGCTCGCTAAGAAC GAGGAGGTAGTGAACGTGATCGTTGAAGGCGGTGCGGTTCCGGCTCTGGTGAAGCATCTT CAAGCGCCGCCTTTAAGCGAAGGAGACCGGAGTTCGAAGCCGTACGAACACGAGGTCGAG AAGGGAAGTGCCTTTGCACTAGGCCTTCTCGCAGTTAAGCCTGAGCATCAACAACTCATC GTTGACACTGGTGCGCTGGCTCATCTTGTGGATTTGTTAAAGAGGCACAAGGATAGTCCT GTATCCAGGGCTTTGTATAGCGTCATTCGTAGAGCTGCTGATGCCATCACCAACCTTGCT CATGAAAACAGCAGCATTAAAACACGTGTCAGAATAGAAGGCGGAATTCCACCTCTAGTT GAGTTGCTTGAATTTGCTGATACCAAGGTGCAAAGAGCAGCTGCTGGAGCACTACGAACC CTGGCATTTAAAAATGATGAGAATAAGAATCAAATTGTCGAATGCAATGCTCTTCCTACC CTCATTCTAATGCTTCGGTCCGAGGATGCTGCTATACATTATGAAGCGGTTGGTGTTATT GGAAATCTGGTACACTCATCTCCGAACATAAAGAAAGAAGTTCTTCTTGCGGGAGCTTTA CAACCTGTTATTGGATTGCTTAGGTGCGTCCCAATAGTTGCTTTTTTCTTGCCCTGTTGC TTCGATGCGGATAATTATCTTCACGTTCACATTGTACAGAGGGGTGCTGTCCGACCTTTG ATTGAGATGCTTCAATCCCCTGATGTACAACTAAGGGAGATGTCAGCTTTTGCATTGGGG AGATTGGCACAGGACACAAACAACCAAGCTGGTATTGCTCATAATGGTGGTTTATTGCCA TTGCTGAAGCTTCTTGATTCGAAAAATGGGTCTCTGCAACATAATGCTGCATTTACTCTT TATGGCCTTGCAGATAATGAGGATAATGTGTCCGATTTTATTAGGGTTGGAGGTGTTCAG AAGCTGCAGGATGGAGAATTTATTTTTCAAGCGACAAAGGATTGTGTGACCAAAACATTG AAAAGATTAGAGGAGAAGATTCATGGACGAGTTTTGTCCCATTTGTTATATTTGATGCGT GTAGCAGAGAGGGTTGTCCAGAAACGAGTTGCTTTGGCTTTTGCTCATCTTTGTTCCCCA GATGATCTGAGAACAATATTCATTGACAACAATGGCATGTCACATCCTCTGTATTTAAAT CATACTTTTCATGGGCTGGAGTTGCTTCTTGGGCTTCTTGGCTCTACTACCCATAAACAG CAACTTGATGCTGCTATGGCTTTGTATAAGTTGGCCAACAAAGCCATGACTCTTTCTCCT GTGGATGCAGCTCCCCCATCTCCGACACCACAGGTCTATCTAGGGGAGCAGTATGTAAAC AATCCCACACTGTCCGATGTTATATTTTTAGTTGAAGGTAAACGGTTCTATGCTCACAGA ATTTGCTTGCTTGCTTCTTCAGATGCATTTCGTGCAATGTTTGATGGTGGTTACCGGGAG AAGGATGCAAGGGACATAGAGATACCAAATATTAGATGGGAGGTTTTCGAGTTGATGATG AGATTTATATACACTGGATCAGTGGACATTACTCTTGATATTGCTCAAGATCTCCTCAGA GCTGCAGATCAGTATCTTCTGGAGGGACTGAAGCGGCTTTGTGAGTATACAATAGCACAG GACGTATCATTGGAGAATGTTTCAAACATGTATGAACTTTCAGAAGCCTTCCATGCAATG TCATTAAGGCACACATGCATTTTGTTTATTTTGGAGCAGTTTGAAAAATTGAGTGCCAGA CCAGGGTATGTGCTTCTTCCAACCTTTGGTTCTTATCCAAAATTATCTCTTCCCATGCAG ATTAAGATGGATTTCTTCTTTTTCCTTAAAAAAGATATGCAGGAAAGTTTGCAATGCATT GGGAGTTACACCATGCACTCTCATTTGATCATGCGTATAATACCCGAGATCTGCACTTAC TTTACTAAAGCGCTTACTAAGCCTAACCCACATAATTTGCGGCTATAA
PEP MELQRRQDQNHPERKGQKRKLEEEIGDEREISVKSGEARKALLSEVSEQVKVLNSTFSWS EADRASAKRSTHVLAELAKNEEVVNVIVEGGAVPALVKHLQAPPLSEGDRSSKPYEHEVE KGSAFALGLLAVKPEHQQLIVDTGALAHLVDLLKRHKDSPVSRALYSVIRRAADAITNLA HENSSIKTRVRIEGGIPPLVELLEFADTKVQRAAAGALRTLAFKNDENKNQIVECNALPT LILMLRSEDAAIHYEAVGVIGNLVHSSPNIKKEVLLAGALQPVIGLLRCVPIVAFFLPCC FDADNYLHVHIVQRGAVRPLIEMLQSPDVQLREMSAFALGRLAQDTNNQAGIAHNGGLLP LLKLLDSKNGSLQHNAAFTLYGLADNEDNVSDFIRVGGVQKLQDGEFIFQATKDCVTKTL KRLEEKIHGRVLSHLLYLMRVAERVVQKRVALAFAHLCSPDDLRTIFIDNNGMSHPLYLN HTFHGLELLLGLLGSTTHKQQLDAAMALYKLANKAMTLSPVDAAPPSPTPQVYLGEQYVN NPTLSDVIFLVEGKRFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNIRWEVFELMM RFIYTGSVDITLDIAQDLLRAADQYLLEGLKRLCEYTIAQDVSLENVSNMYELSEAFHAM SLRHTCILFILEQFEKLSARPGYVLLPTFGSYPKLSLPMQIKMDFFFFLKKDMQESLQCI GSYTMHSHLIMRIIPEICTYFTKALTKPNPHNLRL


| Top |