Cherry SNP DataBase

Gene information

Gene Pav_sc0003169.1_g240.1.mk
Chromosome name PAV_r1.0chr1
start 10178760
end 10183548
PAV_r1.0 name Pav_sc0003169.1
start 113587
end 118375
direction -
Annotation NR PREDICTED: sugar transport protein 13-like
Sequence CDS ATGGCTGGTGGAGGAATCTCAGGAGGATGGGGCTGGAGGGTGTCATTGGGGTTGGCTGGT CTTCCGGCTGGTCTCCTAACCTTGGGAGCCCTTTTGGTGGTGGAAACTCCCAACAGTCTT GTAGAGCGCGGTCTCTTAGAAGAAGGAAAAGCTGTACTTAGGAGGATCCGGGGCACTGAT AATGTGGAACCAGAGTTCTTGGAACTTGTTGAGGCTAGTCGCATCGCTAAAGAAGTGAAG CACCCCTTTAGAAATCTCTTAAAGCTTAGGAATCGCCCCCAACTTATCATTGCAGTATCC ATGCAGATCTTTCAACAATTTACTGGCATCAACGCAATTATGTTTTACGCGCCAGTCCTA TTCAACACATTAGGATTTGGCAACGACGCTGCCCTCTACTCAGCTGTTATAACAGGGGCC GTCAATGTTCTCGCCACTGTTGTATCCATCTACTCAGTTGATAAAGTAGGCCGTCGCATG CTGTTACTGCAAGCCGGAGTTCAAATGTTCCTGTCTCAAGTGGTTATAGCCGTAATACTA GGACTCAAGGTCAAGGACCACTCTGATAACCTTCACAAAGGCTTTGCAATCTTTGTGGTG GTTCTGGTTTGCACTTACGTAGCTGCATTTGCTTGGTCTTGGGGACCTCTAGGTTGGCTG ATACCTAGTGAGACATTCCCGCTAGAGACCCGCTCAGCCGGGCAAAGTGTGACCGTCTGC ACCAACTTGCTCTTCACTTTTGTCATAGCACAGGGCTTCCTCTCAATGCTTTGCCACTTC AAGTTTGGCATCTTCCTCTTCTTCTCCGGCTGGGTCTTAATTATGTCATTCTTTGTGCTG TTCCTGCTCCCGGAGACGAAAAACATCCCAATTGAAGAAATGACAGAGAGGGTATGGAAG CAGCATTGGCTTTGGAAGAGGTTCATGGATGACTACCACATTGAAGGAAATCAGATTGCT GGAGATGACTTAAAGAAAAACGGGCATGCTAATGGATTTGATCCTGTTTCTCAGCTGTAA
PEP MAGGGISGGWGWRVSLGLAGLPAGLLTLGALLVVETPNSLVERGLLEEGKAVLRRIRGTD NVEPEFLELVEASRIAKEVKHPFRNLLKLRNRPQLIIAVSMQIFQQFTGINAIMFYAPVL FNTLGFGNDAALYSAVITGAVNVLATVVSIYSVDKVGRRMLLLQAGVQMFLSQVVIAVIL GLKVKDHSDNLHKGFAIFVVVLVCTYVAAFAWSWGPLGWLIPSETFPLETRSAGQSVTVC TNLLFTFVIAQGFLSMLCHFKFGIFLFFSGWVLIMSFFVLFLLPETKNIPIEEMTERVWK QHWLWKRFMDDYHIEGNQIAGDDLKKNGHANGFDPVSQL


| Top |