Cherry SNP DataBase

Gene information

Gene Pav_sc0003201.1_g040.1.mk
Chromosome name PAV_r1.0chr7
start 8792606
end 8803715
PAV_r1.0 name Pav_sc0003201.1
start 26495
end 37604
direction +
Annotation NR PREDICTED: trafficking protein particle complex subunit 8
Sequence CDS ATGGAAGAAAGAAAAGCTGTAGTAAGTAGGGTTCTTTTACACTCCATTGAGATACATACC CTAATATTTTGTTCTTCATCACCATACGCAGAAGCTGTCAAGGTTGATATCGAATTCAAA AATCCGTTGCAAATCCCCCTCCTCCTGTCTAGTGTATCCCTAATATGCGAGCTTTCAGAA AACTCTGATGAAATGCAATCTGATGCAAATAGCTTGTTGGTGGGGCTTCAGAATGATGGT GAATCTACTAAATTAAACCATAGGGATGTAAACTTTGAGAATTCTTTACTTTCTGTGTCG GATGTTGGCTTTTCATTAAGGGGAGGTGAAACAACTGTGGTGCAACTAACGGTTACGCCT AGAGTAGAAGGCATTTTACAAATTGTTGGTGTAAAGTGGAAATTGTCAGGTTTTGTTGTT GGTTTCCATAAATTTGAGACTAACCCTGTGAAGATGATAAGAAAGCGAGTACAGAAGGCC AAGCATCCTCATAGTGATAATTTAAAGTTTGTAGTTGTTAAGAGTGTACCAAAGCTTGAG GGTGTCATTCATCCACTACCTAAAAGGGCATATGTGGGAGATTTACGGAATCTTGTGTTG GAGTTGAGGAACAAATCTGAATTTGCAGTGAAGAATCTGAAAATGAAGATTAGTCATCCT AGATTCCTGAATATCGGGAAGCGAGAAAGTTTGAACACAGAGTTTCCTGCTTGCTTAGAA AAGACAAATTCTGATCATTCTGGTGTTCCTGCTAACCATACTGACGTTTCTCATTCCATG TTTCTATTTCCAGAGGACACGATAATTCAAGGGGAAACACCATTATTGTGGCCTCTTTGG TTTCGGGCAGCTGTTCCTGGGAACATTTCCTTGTGCATAACTATATATTATGAGATGGGA GATATTTCAAGCACCATGAGATATCGCACTTTACGCATGCATTACAACTTACAGGTATTG CCCTCATTAGATGTGTCATTCCAAATCAGTCCTTGTCCATCAAGATTGCAAGAGTTCCTT GTGCGCATGGATGTTGTCAACAAGACCAGCTCAGAGAGTTTCCAGGTTCATCAGTTGTCG TCCGTTGGGCACCAATGGGAAATCTCATTACTTCAACCTGTTGATGCCATCTTTCCTTCA CAATCTTTAATGGCTCATCAAGCGTTGTCATGTTTCTTCATGCTCAAGAATCATGGCAAG CCATCAACTTCTGAAGATGAGATATCTTCTCATTTCCGACTTCAGGGAACTGATGTGAGA TTGGGTACTCAGGGCAGTAGTGAACCGCTTTTTGATATAGCTAGCTCTCCCCTGGCAGAT TTCCACCATTGTGAAAGACTGCACCAAGAAATTTTACATAAGGTTGATAGAATTCTTGCT ATAACGGGAGACACCAGTACAGTTGACTTCATATTGATTTCTCGGCCTCTGAAGAATGAC AATAATCCTGTGGGTTCCGATCCACCACATCTTTTTTCTCATCATGCGTGTCACTGCAGG CAAGTACTGTTTCAATATCAAAGTACTGCAAGCACAAGTTCTATATCATGGCTAGTTGAC GGACCTCGAACCATATATCATGACTTCTCTGCTCCTTTCTGTGAAATAAATCTTAGCATG ACTTTATTCAACTCATCGGATGTCGTTGCGTCTGTACACATAAACACCTTGGACTCCAGT ACTAGTGATAATTTAAATGATGCAACTCCAGTTCAACCGGCCACGTCTTCTGACAACCAA GAAGGGTGGCATGACCTCTCCTTAGTGACTGACATCAAGGTGACGTCTGATGTCCTTAAA GTCCGGACAAGTAAATCAACGCCGGTGGAGAGTGCATCCTCGTTTATTTGGTCTGGGTCA AGCTCTACCAGAGTCCAACTTGAGCCTATGTCAAGAACTGAAATTCCTCTTCAAGTTTGT GTATTCTCTCCCGGGACTTATGATCTGTCAAACTATGTTTTGCATTGGAATCTTTTAGTT TCTAATGATCAAGGAAACCGTGATAGAAGATCGTCTGGGAAATGCCAGGGATATCCCTAT TACCTTACAGTGCTCCAGTCAGATTAA
PEP MEERKAVVSRVLLHSIEIHTLIFCSSSPYAEAVKVDIEFKNPLQIPLLLSSVSLICELSE NSDEMQSDANSLLVGLQNDGESTKLNHRDVNFENSLLSVSDVGFSLRGGETTVVQLTVTP RVEGILQIVGVKWKLSGFVVGFHKFETNPVKMIRKRVQKAKHPHSDNLKFVVVKSVPKLE GVIHPLPKRAYVGDLRNLVLELRNKSEFAVKNLKMKISHPRFLNIGKRESLNTEFPACLE KTNSDHSGVPANHTDVSHSMFLFPEDTIIQGETPLLWPLWFRAAVPGNISLCITIYYEMG DISSTMRYRTLRMHYNLQVLPSLDVSFQISPCPSRLQEFLVRMDVVNKTSSESFQVHQLS SVGHQWEISLLQPVDAIFPSQSLMAHQALSCFFMLKNHGKPSTSEDEISSHFRLQGTDVR LGTQGSSEPLFDIASSPLADFHHCERLHQEILHKVDRILAITGDTSTVDFILISRPLKND NNPVGSDPPHLFSHHACHCRQVLFQYQSTASTSSISWLVDGPRTIYHDFSAPFCEINLSM TLFNSSDVVASVHINTLDSSTSDNLNDATPVQPATSSDNQEGWHDLSLVTDIKVTSDVLK VRTSKSTPVESASSFIWSGSSSTRVQLEPMSRTEIPLQVCVFSPGTYDLSNYVLHWNLLV SNDQGNRDRRSSGKCQGYPYYLTVLQSD


| Top |