Cherry SNP DataBase

Gene information

Gene Pav_sc0003258.1_g010.1.mk
Chromosome name PAV_r1.0chr8
start 8827955
end 8830858
PAV_r1.0 name Pav_sc0003258.1
start 292
end 3195
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103335663
Sequence CDS ATGTCATTGGAGGTGGTGAAGGAAGACGAAGAAGTTTACAGCTGGAGAGAAGTGAACCTG GCGTCGATCCCAGAGCTTGAGAGGGAGACGGTGGAGAGAAGGCGTGGCCGTGACATAGTC ATAGCTGTGGATCATGGGCCCAACAGCAAGCACGCTTTCGATTGGGCCCTTATTCACTTT TGCAGGCTTGCTGATACCATCCATCTTATTCATGCGGTTTCCAGTGTGAACAACGAGATT GTTTACGATGCGAGCCAGGTCCTGATGCAGAAGCTTGCAATTGAGGCATTTGAAGTTGCC ATGGTGAGGACGATTGCACGAATTGTGCAAGGAGATCCAGGTAAGGTAATTTGCAAGGAA GCAGAGCGTGTAAAGCCTGCAGCTGTTATCCTGGGTACCAGAGGCAGGGGCTTCATTCAA AGTGTACTACAGGGAAGTGTCAGCGAGTATTGCATGCACAACTGTAAATCAGCTCCTGTT GTAATCGTTCCAGGGAAAGAAGCTGGAGACGAGTCGTTGATCTAG
PEP MSLEVVKEDEEVYSWREVNLASIPELERETVERRRGRDIVIAVDHGPNSKHAFDWALIHF CRLADTIHLIHAVSSVNNEIVYDASQVLMQKLAIEAFEVAMVRTIARIVQGDPGKVICKE AERVKPAAVILGTRGRGFIQSVLQGSVSEYCMHNCKSAPVVIVPGKEAGDESLI


| Top |