Cherry SNP DataBase

Gene information

Gene Pav_sc0003383.1_g160.1.mk
Chromosome name PAV_r1.0chr7
start 5884317
end 5887377
PAV_r1.0 name Pav_sc0003383.1
start 71068
end 74128
direction -
Annotation NR PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At5g06940
Sequence CDS ATGGCTACCACCTGCACATTTCCTTTGTTTCTCTCTCTAGTCTCCACATTCCTCATTCTC AGTTCATCATCTTCTGAGGCAGACATTCTTCTCACCTTCAAGGCTTCCATTAAAGACTCT AAAAACTCTCTCTCAAGCTGGTCCAACTCCTCTCTCACTCATTTTTGTCAATGGACTGGA ATTACCTGCACAACCACAGCTCCACTCTCTGTGACTTCTCTCAACCTCCAAAGCTTGAAC CTTTCAGGTGAAATTCCATCTTCAATATGTGAGCTTCCCAATCTGTCTCAGCTCAACCTT GCTGAAAATCTCTTCAGCCAGCCCATCCCTCTCCATCTCTCTCAATGCACTTCTTTGGAG ACTTTGAATCTCAGCAACAATCTCATCTGGGGTACAATCCTAAACCAGATTTCTCAGTTT GGTTCCTTGAAAGTGCTTGACTTGAGCAAGAACCGTCTTGAAGGAAACATCCCACAAGGC ATAGGCTCGCTCAGCAACCTCCAAGTTCTCAACTTGGGAAGCAACTCGCTTTCAGGTAGT GTGCCTTCTATCTTTGGGAATTTAACTGAGCTAGCTGTTCTTGATCTGTCTCAAAATTCA AACTTGGCGAGTGAGATTCCTACTGATATTGGTAAGCTTGTGAAGCTTGAGAAGTTATTC TTGCAAAGCTCTGGTTTTCATGGTGAGATTCCTGAATCTTTGGTGGGTTTGCGAAGTTTG ACTGTTTTAGACCTTTCCCAGAATAACTTAACAGGTAGGGTTCCTCAGACACTAGGCTCT TCTCTCCAGAACTTGGTGTCTTTTGATGTATCTGAGAACAGGCTTTCTGGGCCATTCCCA AATGGCATCTGTACTGGAAAAGGCCTTATAAACCTCAGCCTTTATACCAATGTCTTCAAT GGTTCAGTACCCAACTCCATTAGTGAATGCTTAAATCTAGAGAGGTTTGAAGTTCAGAAC AATTTATTTTCTGGGGATTTCCCAGTGGGGTTATGGTCTTTACCCAAAATTAAGCTTTTG AGAGCTGAAAATAATAGATTTTCTGGAGAAATACCTGATTCAGTATCAATGGCTGCTCAA TTGGAGCAGGTTCAAATAGATAACAACAGCTTCAGAAGCAAAATTCCTCAGGGTCTTGGG TTAGTCAAGAGCTTGTATAGATTCTCTGCTTCTCTGAACGGTTTATATGGTGAACTTCCT CCAAATTTCTGTGATTCCCCTGTTATGAGTATAGTAAATCTCTCCCATAATTCACTTTCG GGTCGAATTCCGGAGGTTAAAAAATGCAGGAAGCTAGTATCATTGTCTTTGGCTGGCAAC AGTCTTAATGGGAATATCCCATCATCTCTTGGTGAATTACCAGTGCTAACTTACCTTGAT CTTTCTGATAATAAGCTTGCCGGTCCAATCCCGCAGGCACTTCAGAACTTGAAGCTTGCA CTCTTCAATGTTTCTTCTAATCAGCTATCTGGTAGAGTCCCCTACTCTCTTATTTCAGGC CTGCCAGCTTCATTTCTTCAAGGAAACCCTGACCTTTGTGGTCCAGGATTACTCAATCCT TGTTCTGATGACCAACCAAAACACCATTCTTTTGATCTCACAATCTTGACATGTGCCCTG ATCTCTATAGCTTTTGCTGTTGGAACTTTCATTGTTGCTGGTGGGTTTATCGCATATCAT CGATATCGCAAGCAGAGATCCCAAGTTGGCATTTGGCGGTCGGTGTTCTTTTATCCTCTC AGAGTCACTGAGCATGATTTGGTGATGGGAATGGATGAGAAAAGTGCTGCAGGAAGTGCT GGAGTATTTGGTAGAGTTTATATTGTAAGTTTACCAAGTGGGGAACTTGTTGCTGTAAAG AAGCTTGTGAATTTTGGGGTCCAGTCTTCCAAAGCTTTGAAGGCTGAGATCAAGACCTTG GCCAAGATCAGGCACAAAAATGTTGTGAAAGTTCTGGGGTTCTGCCATTCCGATGATTCG ATATTTCTGATATATGAAATACAAGTACAGTAA
PEP MATTCTFPLFLSLVSTFLILSSSSSEADILLTFKASIKDSKNSLSSWSNSSLTHFCQWTG ITCTTTAPLSVTSLNLQSLNLSGEIPSSICELPNLSQLNLAENLFSQPIPLHLSQCTSLE TLNLSNNLIWGTILNQISQFGSLKVLDLSKNRLEGNIPQGIGSLSNLQVLNLGSNSLSGS VPSIFGNLTELAVLDLSQNSNLASEIPTDIGKLVKLEKLFLQSSGFHGEIPESLVGLRSL TVLDLSQNNLTGRVPQTLGSSLQNLVSFDVSENRLSGPFPNGICTGKGLINLSLYTNVFN GSVPNSISECLNLERFEVQNNLFSGDFPVGLWSLPKIKLLRAENNRFSGEIPDSVSMAAQ LEQVQIDNNSFRSKIPQGLGLVKSLYRFSASLNGLYGELPPNFCDSPVMSIVNLSHNSLS GRIPEVKKCRKLVSLSLAGNSLNGNIPSSLGELPVLTYLDLSDNKLAGPIPQALQNLKLA LFNVSSNQLSGRVPYSLISGLPASFLQGNPDLCGPGLLNPCSDDQPKHHSFDLTILTCAL ISIAFAVGTFIVAGGFIAYHRYRKQRSQVGIWRSVFFYPLRVTEHDLVMGMDEKSAAGSA GVFGRVYIVSLPSGELVAVKKLVNFGVQSSKALKAEIKTLAKIRHKNVVKVLGFCHSDDS IFLIYEIQVQ


| Top |