Cherry SNP DataBase

Gene information

Gene Pav_sc0003426.1_g050.1.mk
Chromosome name PAV_r1.0chr2
start 4154797
end 4157961
PAV_r1.0 name Pav_sc0003426.1
start 32169
end 35333
direction -
Annotation NR PREDICTED: calcium/calmodulin-dependent serine/threonine-protein kinase-like
Sequence CDS ATGGGACAAGAAACAAGAAGACTGGCAGATGAGTATGAGATATCAGAGATTTTAGGCAGA GGAGGATTCTCTGTAGTGAGAAAAGGCATCAGCAGAAAATCAGGCAGCAGTGACAAAAAC AATGTGGCAATCAAGACCCTCAAAAGGCCATTTGGACCATCAAACCCTCCGCCCGGCAGA TCGGGTGCCGGAGATCATCAGAAAAGCTTTGCTGCTGCTTTCCAAGCCCGGAAGCAGGTG TCCATATCAAATGTCTTGCTCACAAATGAAATCTTGGTCATGAGGAGAATAGTTGAAAAT GTCTCACCACACCCAAATGTCATTGACCTCTATGATGTGTATGAGGATGAAAATGGGGTC CACCTTGTGTTGGAGCTTTGCTCTGGGGGTGAACTGTTTGATAGGATTGTGAAGCAAGCA AGGTATTCTGAGGCTGGAGCTGCAGCTGTGGTTAGGCAGATTGCTCAAGGCTTAGCAGCT CTTCACAAGTCCAATATTGTTCACAGGGACTTGAAGCCAGAGAACTGCCTGTTCTTGAAT AATAGTGATGATTCTTCTTTGAAGATTATGGATTTTGGGCTCAGTTCTGTGGAGGAGTTT ACTGATCCTGTTGTTGGGTTGTTTGGTTCAATAGATTATGTCTCCCCAGAGGCTCTTTCT CAGGGACAAGTCACTTCTAAGAGTGATATGTGGGCTCTGGGTGTAATCTTGTATATCCTT CTCTCTGGGTACCCACCTTTTATTGCTCAGTCGAATCGGCAAAAGCAACAGATGATAATG GCTGGAGAATTCAGTTTCTATGAGAAAACTTGGAAGGGCATTTCTTTGTCAGCAAAGCAA TTAATTTCGGATCTCCTCAAAGTTGACCCTGACAAGAGACCTAGTGCTCAAGAGCTTCTG GACCATCCATGGGTTGTAGGTCTTTCAGCCAGAGAAGATCAAATGGATGCTGAGATTGTG TCACGACTGCAGAGTTTTAATGCTCGGCGAAAACTCCGTGCTGCAGCAATAGCTAGTGTG TGGACCAGCTCGATTTTCTTAAGGACGAAGAAGCTAAAATCACTACTAGGTTCCCACGAC CTTAAACCGGATGAAATCCAGAAACTGAGTTTACATTTCAAGAAAATATGTGTAAAAGGT GACAATGCTACTCTATCTGAATTTGAGGAGGTGCTGAAAGCAATGAACATGTCGTCATTA ATCCCTTTGGCACCCCGGATCTTTGACCTATTCGACAACAATCGCGATGGAACAGTTGAC ATGCGAGAGATCCTCTGTGGGTTCTCTAGTCTCAAGAATTCACAAGGAGATGATGCACTC CGCCTGTGCTTCCAGATGTACGATACGGATCGGTCTGGATGCATCAGTAAAGAAGAAGTG GCATCTATGCTCAGGGCTTTACCAGATGACTGCCTTCCAGCTGATATCACTGAACCTGGA AAATTGGATGAAATATTTGATCGCATGGATGCAAACAGTGATGGACAAGTTACCTTTGAT GAGTTCAAAGCTGCCATGCAGAGAGACAGCTCCCTCCAAGATGTAGTCCTCTCCTCTCTT CGACCGTTATAG
PEP MGQETRRLADEYEISEILGRGGFSVVRKGISRKSGSSDKNNVAIKTLKRPFGPSNPPPGR SGAGDHQKSFAAAFQARKQVSISNVLLTNEILVMRRIVENVSPHPNVIDLYDVYEDENGV HLVLELCSGGELFDRIVKQARYSEAGAAAVVRQIAQGLAALHKSNIVHRDLKPENCLFLN NSDDSSLKIMDFGLSSVEEFTDPVVGLFGSIDYVSPEALSQGQVTSKSDMWALGVILYIL LSGYPPFIAQSNRQKQQMIMAGEFSFYEKTWKGISLSAKQLISDLLKVDPDKRPSAQELL DHPWVVGLSAREDQMDAEIVSRLQSFNARRKLRAAAIASVWTSSIFLRTKKLKSLLGSHD LKPDEIQKLSLHFKKICVKGDNATLSEFEEVLKAMNMSSLIPLAPRIFDLFDNNRDGTVD MREILCGFSSLKNSQGDDALRLCFQMYDTDRSGCISKEEVASMLRALPDDCLPADITEPG KLDEIFDRMDANSDGQVTFDEFKAAMQRDSSLQDVVLSSLRPL


| Top |